Protein detail
SO3A1
Solute carrier organic anion transporter family member 3A1 (OATP3A1) (Organic anion transporter polypeptide-related protein 3) (OATP-RP3) (OATPRP3) (Organic anion-transporting polypeptide D) (OATP-D) (PGE1 transporter) (Sodium-independent organic anion transporter D) (Solute carrier family 21 member 11)
Entry name SO3A1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 12 | Protein classification Metabolic proteinsPlasma proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Solute carrier organic anion transporter family member 3A1 (OATP3A1) (Organic anion transporter polypeptide-related protein 3) (OATP-RP3) (OATPRP3) (Organic anion-transporting polypeptide D) (OATP-D) (PGE1 transporter) (Sodium-independent organic anion transporter D) (Solute carrier family 21 member 11)
Protein Class (4)
Metabolic proteinsPlasma proteinsPredicted membrane proteinsTransporters
Protein Function
Transporters:Electrochemical Potential-driven transporters
Transmembrane
41..60; Helical; Name=1; 80..100; Helical; Name=2; 107..131; Helical; Name=3; 175..203; Helical; Name=4; 223..243; Helical; Name=5; 262..286; Helical; Name=6; 345..366; Helical; Name=7; 387..410; Helical; Name=8; 415..438; Helical; Name=9; 540..562; Helical; Name=10; 572..597; Helical; Name=11; 631..648; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
OATP-DOATP3A1SLC21A11
Gene Description
Solute carrier organic anion transporter family member 3A1
Chromosome
15
Position
91853708-92172435
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificDistal convoluted tubule cells
Function & Pathway
Protein Function
Transporters:Electrochemical Potential-driven transporters
Cellular Component (4)
Molecular Function (4)
Biological Process (3)
Reactome (4)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence25
Ligand-Receptor Signaling (24)
24 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| basolateral_cell_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 36008522 |
Sequence, Structure & Domains
Sequences
Length
710
Mass
76,553
Sequence
MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPHSEPAMESEQAMLSEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVPYGNSTAPGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPSPGCQEAFLTFLCVMCICSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVSIAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSEFFASTLTLDNLGRDPVPANQTHRTKFIYNLEDHEWCENMESVL
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=OATP3A1-v1; IsoId=Q9UIG8-1; Sequence=Displayed; Name=2; Synonyms=OATP3A1-v2; IsoId=Q9UIG8-2; Sequence=VSP_036837, VSP_036838; Name=3; IsoId=Q9UIG8-3; Sequence=VSP_036834, VSP_036835, VSP_036836; Name=4; IsoId=Q9UIG8-4; Sequence=VSP_036833; Name=5; Synonyms=OATP3A1-v3; IsoId=Q9UIG8-5; Sequence=VSP_062679
Alternative Sequence
1..281; Missing (in isoform 4); 1..58; Missing (in isoform 3); 59..60; YL -> MN (in isoform 3); 641..710; Missing (in isoform 3); 666..709; SEFFASTLTLDNLGRDPVPANQTHRTKFIYNLEDHEWCENMESV -> TSEPDRIQNKERMTSCGRVLEATCAAGPQSL (in isoform 5); 667..692; EFFASTLTLDNLGRDPVPANQTHRTK -> TEYQDIETEKTCPESHSPSEDSFVRS (in isoform 2); 693..710; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
1..15; Gly residues
Domain (FT)
465..513; Kazal-like
Region
1..25; Disordered
Protein Families
Organo anion transporter (TC 2.A.60) family
Sequence Similarities
Belongs to the organo anion transporter (TC 2.A.60) family.
Clinical Relevance
Drugs (3)
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 39329301 | Blood and cerebrospinal fluid biomarkers in neuro-oncology. | In meningiomas, the low concentration of ctDNA is a limiting factor for the detection of driver mutations, such as NF2, AKTs, SMO, KLF4, TRAF7, SMARCB1, SMARCE1, PTEN, and TERT; an alternative approach could be the isolation of ctDNA through circulating extracellular vesicles. |