Protein detail
DBNL
Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7)
Entry name DBNL | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 28 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ABP1HIP-55SH3P7
Gene Description
Drebrin like
Chromosome
7
Position
44044640-44069456
Supporting publications (n)
28
EVMP confidence score
0.88
Fluorescence & Localization3
Tissue SpecificintestineCell SpecificColonocytes
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (23)
- GO:0000139 Golgi membrane
- GO:0001726 ruffle
- GO:0002102 podosome
- GO:0005576 extracellular region
- GO:0005737 cytoplasm
- GO:0005769 early endosome
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005938 cell cortex
- GO:0014069 postsynaptic density
Page 1 of 3
Molecular Function (7)
Reactome (10)
- R-hsa-109581 apoptosis
- R-hsa-111465 apoptotic cleavage of cellular proteins
- R-hsa-75153 apoptotic execution phase
- R-hsa-264870 caspase mediated cleavage of cytoskeletal proteins
- R-hsa-168249 innate immune system
- R-hsa-6794361 neurexins and neuroligins
- R-hsa-112316 neuronal system
- R-hsa-6798695 neutrophil degranulation
- R-hsa-5357801 programmed cell death
- R-hsa-6794362 protein protein interactions at synapses
Mediation Categories (3)
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence26
Enzyme-Mediated Modification (10)
10 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DBNL | ZAP70 | P43403 | Y | 334 | phosphorylation | PhosphoNetworksSparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:14557276HPRD:14557276SIGNOR:14557276phosphoELM:14557276ProtMapper:14557276 |
| DBNL | ZAP70 | P43403 | Y | 344 | phosphorylation | PhosphoNetworksSparser_ProtMapperSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:14557276HPRD:14557276SIGNOR:14557276phosphoELM:14557276ProtMapper:14557276 |
| DBNL | ZAP70 | P43403 | Y | 335 | phosphorylation | HPRDKEA | KEA:14557276HPRD:14557276 |
| DBNL | ZAP70 | P43403 | Y | 345 | phosphorylation | HPRDKEA | KEA:14557276HPRD:14557276 |
| DBNL | ZAP70 | P43403 | Y | 343 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| DBNL | ZAP70 | P43403 | Y | 353 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| DBNL | SYK | P43405 | Y | 344 | phosphorylation | Li2012 | |
| DBNL | CDK2 | P24941 | S | 283 | phosphorylation | MIMPHPRD_MIMPPhosphoSite_MIMP | |
| DBNL | CDK2 | P24941 | S | 284 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| DBNL | MELK | Q14680 | S | 269 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:23283305 |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | GO_Intercell | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ZAP70 | P43403 | DBNL | Q9UJU6 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangPhosphoSite_ProtMapperHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteSparser_ProtMapperSPIKE_LCSPIKE | KEA:14557276SPIKE:16189514HPRD:14557276ProtMapper:31377908SIGNOR:14557276phosphoELM:14557276SPIKE:14557276SPIKE_LC:14557276ProtMapper:14557276SPIKE_LC:16189514HPRD-phos:14557276PhosphoSite:14557276 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| DBNLFGD6HERC2NEURL4ZBTB5 | O15062O95714Q6ZV73Q96JN8Q9UJU6 | 0:0:0:0:0 | hu.MAP2 | |||
| DBNLFGD6HERC2NEURL4 | O95714Q6ZV73Q96JN8Q9UJU6 | 0:0:0:0 | hu.MAP2 | |||
| DBNLHERC2NEURL4 | O95714Q96JN8Q9UJU6 | 0:0:0 | hu.MAP2 | |||
| DBNLFGD6 | Q6ZV73Q9UJU6 | 0:0 | hu.MAP | |||
| DBNLNEURL4 | Q96JN8Q9UJU6 | 0:0 | hu.MAP |
Isolation & Detection Technology (1)
Sequence, Structure & Domains16
Sequences
Length
430
Mass
48,207
Sequence
MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQEQGGEASPQRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVELIE
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q9UJU6-1; Sequence=Displayed; Name=2; IsoId=Q9UJU6-2; Sequence=VSP_011398; Name=3; IsoId=Q9UJU6-3; Sequence=VSP_011398, VSP_011399; Name=4; IsoId=Q9UJU6-4; Sequence=VSP_054779, VSP_011398; Name=5; IsoId=Q9UJU6-5; Sequence=VSP_054780; Name=6; IsoId=Q9UJU6-6; Sequence=VSP_057346, VSP_011398
Alternative Sequence
1..109; MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLK -> MKATAMTSAWLAQG (in isoform 4); 1..103; Missing (in isoform 5); 110..158; Missing (in isoform 6); 234; Q -> QS (in isoform 2, isoform 3, isoform 4 and isoform 6); 251; Q -> QGSTCASLQ (in isoform 3)
3D Structural Models
Turn
108..110
Helix
9..20; 50..56; 91..107; 120..123; 125..133
Beta Strand
22..25; 27..38; 40..48; 61..70; 72..74; 76..85; 111..115
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
233..244; Polar residues; 245..267; Basic and acidic residues; 268..277; Polar residues
Coiled Coil
176..231
Domain (CC)
The SH3 domain mediates interaction with SHANK2, SHANK3 and PRAM1.
Domain (FT)
4..133; ADF-H; 371..430; SH3
Region
219..283; Disordered
Protein Families
ABP1 family
Sequence Similarities
Belongs to the ABP1 family.
Clinical Relevance4
Supporting Publications27
| PMID | Title | Abstract |
|---|---|---|
| 26826536 | [Cardiovascular risk study in patients with renin-angiotensin system blockade by means of the proteone of circulating extracellular vesicles]. | No abstract available |
| 30875722 | Human Heart Explant-Derived Extracellular Vesicles: Characterization and Effects on the In Vitro Recellularization of Decellularized Heart Valves. | No abstract available |
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No abstract available |
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 32560723 | T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 32916986 | Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines. | No abstract available |
| 33304478 | The proteomic landscape of small urinary extracellular vesicles during kidney transplantation. | No abstract available |
| 33309826 | Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts. | No abstract available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No abstract available |
Page 1 of 3Next