Protein detail
DBNL
Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7)
Entry name DBNL | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 27 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Drebrin-like protein (Cervical SH3P7) (Cervical mucin-associated protein) (Drebrin-F) (HPK1-interacting protein of 55 kDa) (HIP-55) (SH3 domain-containing protein 7)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ABP1HIP-55SH3P7
Gene Description
Drebrin like
Chromosome
7
Position
44044640-44069456
Supporting publications (n)
27
EVMP confidence score
0.88
Fluorescence & Localization
Tissue SpecificintestineCell SpecificColonocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (23)
- GO:0000139 Golgi membrane
- GO:0001726 ruffle
- GO:0002102 podosome
- GO:0005576 extracellular region
- GO:0005737 cytoplasm
- GO:0005769 early endosome
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005938 cell cortex
- GO:0014069 postsynaptic density
Page 1 of 3
Molecular Function (7)
Reactome (10)
- R-hsa-109581 apoptosis
- R-hsa-111465 apoptotic cleavage of cellular proteins
- R-hsa-75153 apoptotic execution phase
- R-hsa-264870 caspase mediated cleavage of cytoskeletal proteins
- R-hsa-168249 innate immune system
- R-hsa-6794361 neurexins and neuroligins
- R-hsa-112316 neuronal system
- R-hsa-6798695 neutrophil degranulation
- R-hsa-5357801 programmed cell death
- R-hsa-6794362 protein protein interactions at synapses
Mediation Categories (3)
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence26
Enzyme-Mediated Modification (10)
10 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DBNL | ZAP70 | P43403 | Y | 334 | phosphorylation | PhosphoNetworksSparser_ProtMapperSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:14557276HPRD:14557276SIGNOR:14557276phosphoELM:14557276ProtMapper:14557276 |
| DBNL | ZAP70 | P43403 | Y | 344 | phosphorylation | PhosphoNetworksSparser_ProtMapperSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:14557276HPRD:14557276SIGNOR:14557276phosphoELM:14557276ProtMapper:14557276 |
| DBNL | ZAP70 | P43403 | Y | 335 | phosphorylation | HPRDKEA | KEA:14557276HPRD:14557276 |
| DBNL | ZAP70 | P43403 | Y | 345 | phosphorylation | HPRDKEA | KEA:14557276HPRD:14557276 |
| DBNL | ZAP70 | P43403 | Y | 343 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| DBNL | ZAP70 | P43403 | Y | 353 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| DBNL | SYK | P43405 | Y | 344 | phosphorylation | Li2012 | |
| DBNL | CDK2 | P24941 | S | 283 | phosphorylation | MIMPHPRD_MIMPPhosphoSite_MIMP | |
| DBNL | CDK2 | P24941 | S | 284 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| DBNL | MELK | Q14680 | S | 269 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:23283305 |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | ||||
| ecm | ecm | GO_Intercell | Yes | ||||
| ecm | ecm | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ZAP70 | P43403 | DBNL | Q9UJU6 | Yes | Yes | HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangPhosphoSite_ProtMapperHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteSparser_ProtMapperSPIKE_LCSPIKE | KEA:14557276SPIKE:16189514HPRD:14557276ProtMapper:31377908SIGNOR:14557276phosphoELM:14557276SPIKE:14557276SPIKE_LC:14557276ProtMapper:14557276SPIKE_LC:16189514HPRD-phos:14557276PhosphoSite:14557276 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| DBNLFGD6HERC2NEURL4ZBTB5 | O15062O95714Q6ZV73Q96JN8Q9UJU6 | 0:0:0:0:0 | hu.MAP2 | |||
| DBNLFGD6HERC2NEURL4 | O95714Q6ZV73Q96JN8Q9UJU6 | 0:0:0:0 | hu.MAP2 | |||
| DBNLHERC2NEURL4 | O95714Q96JN8Q9UJU6 | 0:0:0 | hu.MAP2 | |||
| DBNLFGD6 | Q6ZV73Q9UJU6 | 0:0 | hu.MAP | |||
| DBNLNEURL4 | Q96JN8Q9UJU6 | 0:0 | hu.MAP |
Isolation & Detection Technology (1)
Sequence, Structure & Domains
Sequences
Length
430
Mass
48,207
Sequence
MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQEQGGEASPQRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVELIE
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q9UJU6-1; Sequence=Displayed; Name=2; IsoId=Q9UJU6-2; Sequence=VSP_011398; Name=3; IsoId=Q9UJU6-3; Sequence=VSP_011398, VSP_011399; Name=4; IsoId=Q9UJU6-4; Sequence=VSP_054779, VSP_011398; Name=5; IsoId=Q9UJU6-5; Sequence=VSP_054780; Name=6; IsoId=Q9UJU6-6; Sequence=VSP_057346, VSP_011398
Alternative Sequence
1..109; MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLK -> MKATAMTSAWLAQG (in isoform 4); 1..103; Missing (in isoform 5); 110..158; Missing (in isoform 6); 234; Q -> QS (in isoform 2, isoform 3, isoform 4 and isoform 6); 251; Q -> QGSTCASLQ (in isoform 3)
3D Structural Models
Turn
108..110
Helix
9..20; 50..56; 91..107; 120..123; 125..133
Beta Strand
22..25; 27..38; 40..48; 61..70; 72..74; 76..85; 111..115
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
233..244; Polar residues; 245..267; Basic and acidic residues; 268..277; Polar residues
Coiled Coil
176..231
Domain (CC)
The SH3 domain mediates interaction with SHANK2, SHANK3 and PRAM1.
Domain (FT)
4..133; ADF-H; 371..430; SH3
Region
219..283; Disordered
Protein Families
ABP1 family
Sequence Similarities
Belongs to the ABP1 family.
Clinical Relevance
Supporting Publications27
| PMID | Title | Related sentences |
|---|---|---|
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 40465195 | Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome. | No related sentences available |
| 40840701 | Multiomics analysis to evaluate the enrichment of extracellular vesicles from human plasma. | No related sentences available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No related sentences available |
Page 3 of 3Previous