Protein detail

FBW1B

F-box/WD repeat-containing protein 11 (F-box and WD repeats protein beta-TrCP2) (F-box/WD repeat-containing protein 1B) (Homologous to Slimb protein) (HOS)

Entry name FBW1B	UniProt ID Q9UKB1	EVMP confidence score 0.50
Supporting publications (n) 6	Transmembrane count	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

F-box/WD repeat-containing protein 11 (F-box and WD repeats protein beta-TrCP2) (F-box/WD repeat-containing protein 1B) (Homologous to Slimb protein) (HOS)

Protein Class (4)

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Disease related genes
Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
Predicted intracellular proteins

Ensembl

ENSG00000072803

Entrez Gene Symbol

FBXW11

Gene Synonym (7)

BTRC2BTRCP2Fbw11Fbw1bFBXW1BHosKIAA0696

Gene Description

F-box and WD repeat domain containing 11

Chromosome

Position

171861549-172006873

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization5

Tissue SpecifickidneyCell SpecificBreast lactating cellsSingle-Nuclei Brain SpecificBergmann gliaBlood Cell Specificplasmacytoid DCBlood Lineage Specificdendritic cells

Function & Pathway7

Protein Function (3)

Disease related genes
Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
Predicted intracellular proteins

Cellular Component (12)

Page 1 of 2

Molecular Function (5)

Biological Process (3)

KEGG (9)

Reactome (36)

Page 1 of 4

Mediation Categories (3)

Immune mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence40

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (16)

16 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
FBW1B	Q9UKB1	IKBA	P25963	Yes	No	Yes	WangNetPathSIGNORNRF2omeHPRDHINTACSNIntActInnateDBCancerCellMapSPIKE_LCSPIKE	CancerCellMap:10066435 HINT:36608670 HINT:10066435 HINT:27565346 SPIKE:14743216 HINT:24912152 SIGNOR:9990853 SPIKE_LC:14743216 SPIKE:10644755 InnateDB:12165731 HINT:18723677 HINT:14743216 SPIKE:16189514 NRF2ome:10066435 HINT:10230406 SPIKE:10066435 SPIKE_LC:10644755 IntAct:14743216 HINT:17698585 NetPath:10066435 HINT:12482991 InnateDB:10066435 SIGNOR:7479976 HPRD:10644755 ACSN:9859996 HINT:12165731 HINT:33961781 SPIKE_LC:10066435 CancerCellMap:10644755 ACSN:10066435 SPIKE_LC:16189514
FBW1B	Q9UKB1	FBW1A	Q9Y297	Yes	No	Yes	WangNetPathSIGNORHPRDHINTIntActSPIKE_LCSPIKE	NetPath:10066435 SPIKE:16189514 NetPath:15485837 HINT:10644755 SIGNOR:31406304 HPRD:10644755 HINT:19615732 IntAct:10644755 SPIKE_LC:16189514 SPIKE:10644755 SPIKE_LC:10644755 HINT:33961781
FBW1B	Q9UKB1	SMAD3	P84022	Yes	Yes	No	SIGNORSignaLink3	SignaLink3:23331499 SIGNOR:11359933 SignaLink3:11359933
FBW1B	Q9UKB1	CTNB1	P35222	Yes	Yes	Yes	SIGNORHINTSignaLink3IntActWang	HINT:22682247 SIGNOR:10074433 IntAct:22682247 SignaLink3:9784611 SIGNOR:9784611 SignaLink3:23331499
FBW1B	Q9UKB1	SMAD4	Q13485	Yes	Yes	No	SIGNORSignaLink3	SIGNOR:14988407 SignaLink3:14988407 SignaLink3:23331499
FBW1B	Q9UKB1		COMPLEX:P62877_P63208_Q13616	Yes	Yes	No	SIGNOR	SIGNOR:10321728
FBW1B	Q9UKB1	CLSPN	Q9HAW4	Yes	No	Yes	SIGNOR	SIGNOR:16885021
FBW1B	Q9UKB1	SUFU	Q9UMX1	Yes	Yes	No	SIGNORACSN	ACSN:16651270 ACSN:16371461 ACSN:19797085 ACSN:15071497 ACSN:17053147 ACSN:16611981 ACSN:15688063 ACSN:18813803 SIGNOR:10564661 ACSN:12820959 ACSN:15340381
FBW1B	Q9UKB1		COMPLEX:P62877_P63208_Q14999	Yes	Yes	No	SIGNOR	SIGNOR:31092637
FBW1B	Q9UKB1	SKP1	P63208	Yes	Yes	No	WangNetPathSIGNORHINTIntActInnateDBSPIKE_LCLit-BM-17	HINT:10644755 IntAct:19159283 SPIKE_LC:17145710 Lit-BM-17:10644755 HINT:10321728 Lit-BM-17:25609649 SPIKE_LC:19159283 Lit-BM-17:12165731 Lit-BM-17:19615732 Lit-BM-17:26496610 HINT:19615732 HINT:20596027 Lit-BM-17:25332235 IntAct:10644755 SPIKE_LC:10644755 NetPath:10066435 Lit-BM-17:10230406 HINT:12165731 HINT:19159283 Lit-BM-17:10321728 Lit-BM-17:25515538 HINT:33961781 SIGNOR:10023660 HINT:15070733 Lit-BM-17:24500709 Lit-BM-17:15070733 Lit-BM-17:27705803 InnateDB:10321728 IntAct:21145461 Lit-BM-17:19159283 Lit-BM-17:25900982

Page 1 of 2Next

Protein Complex Composition (18)

18 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
BTRC CCNE1 CDC34 CUL1 CUL2 CUL5 DCUN1D1 FBXW11 FBXW7 KLHDC10 NEDD8 RBX1 SKP1 UBC UBE2M	P0CG48 P24864 P49427 P61081 P62877 P63208 Q13616 Q13617 Q15843 Q6PID8 Q93034 Q969H0 Q96GG9 Q9UKB1 Q9Y297	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9770
BTRC CDC34 CUL1 DNAJB2 FBXW11 FBXW2 FBXW7 NEDD8 RBX1 SKP1 SUGT1 UBA52 UBC UBE2R2	P0CG48 P25686 P49427 P62877 P62987 P63208 Q13616 Q15843 Q712K3 Q969H0 Q9UKB1 Q9UKT8 Q9Y297 Q9Y2Z0	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6742
BTRC CDC34 CUL1 CUL5 DCUN1D1 FBXW11 FBXW2 FBXW7 NEDD8 RBX1 SKP1 SUGT1 UBC UBE2M	P0CG48 P49427 P61081 P62877 P63208 Q13616 Q15843 Q93034 Q969H0 Q96GG9 Q9UKB1 Q9UKT8 Q9Y297 Q9Y2Z0	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5044
BTRC CDC34 CUL1 CUL5 DCUN1D1 FBXO9 FBXW11 FBXW2 NEDD8 RBX1 SDSL SKP1 UBC UBE2M	P0CG48 P49427 P61081 P62877 P63208 Q13616 Q15843 Q93034 Q96GA7 Q96GG9 Q9UK97 Q9UKB1 Q9UKT8 Q9Y297	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8132
BTRC CDC34 CUL1 CUL5 DCUN1D1 FBXW11 FBXW2 MYG1 NEDD8 RBX1 SKP1 UBC UBE2M UNC45A	P0CG48 P49427 P61081 P62877 P63208 Q13616 Q15843 Q93034 Q96GG9 Q9H3U1 Q9HB07 Q9UKB1 Q9UKT8 Q9Y297	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5221
CDC25B FBXW11 HIVEP1 HIVEP2	P15822 P30305 P31629 Q9UKB1	0:0:0:0	hu.MAP2
BTRC FBXW11 HIVEP1 HIVEP2 MLPH	P15822 P31629 Q9BV36 Q9UKB1 Q9Y297	0:0:0:0:0	hu.MAP2
CDC25B FBXW11 TFAP4	P30305 Q01664 Q9UKB1	0:0:0	hu.MAP2

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	38453052

Sequence, Structure & Domains13

Sequences

Length

542

Mass

62,091

Sequence

MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=C; IsoId=Q9UKB1-1; Sequence=Displayed; Name=A; IsoId=Q9UKB1-2; Sequence=VSP_006765; Name=B; IsoId=Q9UKB1-3; Sequence=VSP_006766

Alternative Sequence

16..49; Missing (in isoform A); 16..48; CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL -> NTSVMEDQNEDESPKKNTLW (in isoform B)

3D Structural Models

Turn

267..269; 307..309; 390..392; 430..432

Helix

119..125; 129..136; 141..148; 152..160; 163..174; 176..184; 188..190; 202..225; 470..474; 480..482

Beta Strand

229..234; 238..240; 243..248; 250..257; 262..266; 272..276; 283..288; 290..297; 300..306; 312..317; 323..329; 332..337; 340..351; 353..360; 366..371; 373..380; 385..389; 395..399; 406..412; 415..420; 425..429; 435..439; 446..451; 453..460; 463..469; 484..489; 495..501; 504..509; 512..521

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Repeat

238..275; WD 1; 278..315; WD 2; 318..355; WD 3; 361..398; WD 4; 401..440; WD 5; 442..478; WD 6; 490..527; WD 7

Domain (CC)

The N-terminal D domain mediates homodimerization.

Domain (FT)

129..167; F-box

Region

67..116; Homodimerization domain D

Clinical Relevance5

Disease Involvement

Disease variant

Antibody

HPA072204

Interaction Protein (14)

ENSG00000055130ENSG00000084093ENSG00000100906ENSG00000103126ENSG00000113558ENSG00000142166ENSG00000163362ENSG00000164045ENSG00000166167ENSG00000166483ENSG00000168036ENSG00000170802ENSG00000183421ENSG00000184675

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications6

PMID	Title	Abstract
26775013	Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers.	No abstract available
27312428	A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer.	No abstract available
32795414	Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers.	Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers.
33709510	Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.	No abstract available
38490958	Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available