Protein detail
FBW1B
F-box/WD repeat-containing protein 11 (F-box and WD repeats protein beta-TrCP2) (F-box/WD repeat-containing protein 1B) (Homologous to Slimb protein) (HOS)
Entry name FBW1B | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
F-box/WD repeat-containing protein 11 (F-box and WD repeats protein beta-TrCP2) (F-box/WD repeat-containing protein 1B) (Homologous to Slimb protein) (HOS)
Protein Class (4)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (7)
BTRC2BTRCP2Fbw11Fbw1bFBXW1BHosKIAA0696
Gene Description
F-box and WD repeat domain containing 11
Chromosome
5
Position
171861549-172006873
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificBreast lactating cellsSingle-Nuclei Brain SpecificBergmann gliaBlood Cell Specificplasmacytoid DCBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Predicted intracellular proteins
Cellular Component (12)
- GO:0000151 ubiquitin ligase complex
- GO:0000776 kinetochore
- GO:0005634 nucleus
- GO:0005635 nuclear envelope
- GO:0005813 centrosome
- GO:0005829 cytosol
- GO:0005875 microtubule associated complex
- GO:0005881 cytoplasmic microtubule
- GO:0019005 SCF ubiquitin ligase complex
- GO:0043005 neuron projection
Page 1 of 2
Molecular Function (5)
Biological Process (3)
KEGG (9)
- hsa04114 Oocyte meiosis
- KEGG:hsa04120 Ubiquitin mediated proteolysis
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04340 Hedgehog signaling pathway
- KEGG:hsa04390 Hippo signaling pathway
- KEGG:hsa04710 Circadian rhythm
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
Reactome (36)
- R-hsa-1169091 activation of nf kappab in b cells
- R-hsa-1280218 adaptive immune system
- R-hsa-983168 antigen processing ubiquitination proteasome degradation
- R-hsa-1640170 cell cycle
- R-hsa-69620 cell cycle checkpoints
- R-hsa-69278 cell cycle mitotic
- R-hsa-9909396 circadian clock
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-5607764 clec7a dectin 1 signaling
- R-hsa-1280215 cytokine signaling in immune system
Page 1 of 4
Mediation Categories (3)
Immune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence40
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (16)
16 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FBW1B | Q9UKB1 | IKKA | O15111 | Yes | Yes | SIGNOR | SIGNOR:10321728 | |
| FBW1B | Q9UKB1 | EF2K | O00418 | Yes | Yes | SIGNOR | SIGNOR:22669845 | |
| FBW1B | Q9UKB1 | AICDA | Q9GZX7 | Yes | Yes | SIGNOR | SIGNOR:31092637 | |
| FBW1B | Q9UKB1 | PER1 | O15534 | Yes | Yes | InnateDBSIGNOR | SIGNOR:15917223InnateDB:15917222 | |
| FBW1B | Q9UKB1 | IKKB | O14920 | Yes | Yes | SIGNOR | SIGNOR:10321728 | |
| FBW1B | Q9UKB1 | ZN281 | Q9Y2X9 | Yes | Yes | SIGNOR | SIGNOR:29179460 |
Page 2 of 2Previous
Protein Complex Composition (18)
18 records.
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38453052 |
Sequence, Structure & Domains
Sequences
Length
542
Mass
62,091
Sequence
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=C; IsoId=Q9UKB1-1; Sequence=Displayed; Name=A; IsoId=Q9UKB1-2; Sequence=VSP_006765; Name=B; IsoId=Q9UKB1-3; Sequence=VSP_006766
Alternative Sequence
16..49; Missing (in isoform A); 16..48; CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL -> NTSVMEDQNEDESPKKNTLW (in isoform B)
3D Structural Models
Turn
267..269; 307..309; 390..392; 430..432
Helix
119..125; 129..136; 141..148; 152..160; 163..174; 176..184; 188..190; 202..225; 470..474; 480..482
Beta Strand
229..234; 238..240; 243..248; 250..257; 262..266; 272..276; 283..288; 290..297; 300..306; 312..317; 323..329; 332..337; 340..351; 353..360; 366..371; 373..380; 385..389; 395..399; 406..412; 415..420; 425..429; 435..439; 446..451; 453..460; 463..469; 484..489; 495..501; 504..509; 512..521
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Repeat
238..275; WD 1; 278..315; WD 2; 318..355; WD 3; 361..398; WD 4; 401..440; WD 5; 442..478; WD 6; 490..527; WD 7
Domain (CC)
The N-terminal D domain mediates homodimerization.
Domain (FT)
129..167; F-box
Region
67..116; Homodimerization domain D
Clinical Relevance
Disease Involvement
Disease variant
Antibody
Interaction Protein (14)
ENSG00000055130ENSG00000084093ENSG00000100906ENSG00000103126ENSG00000113558ENSG00000142166ENSG00000163362ENSG00000164045ENSG00000166167ENSG00000166483ENSG00000168036ENSG00000170802ENSG00000183421ENSG00000184675
Interaction Count
14
Interaction Dataset
intact_biogrid
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 26775013 | Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers. | No related sentences available |
| 27312428 | A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer. | No related sentences available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |