Protein detail
CHIC2
Cysteine-rich hydrophobic domain-containing protein 2 (BrX-like translocated in leukemia)
Entry name CHIC2 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cysteine-rich hydrophobic domain-containing protein 2 (BrX-like translocated in leukemia)
Protein Class (4)
Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
BTL
Gene Description
Cysteine rich hydrophobic domain 2
Chromosome
4
Position
54009789-54064605
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization
Tissue Specificchoroid plexusBrain Regional Specificbasal gangliaCell SpecificBasal keratinocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Predicted intracellular proteins
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence16
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| transmembrane_predicted | transmembrane | OmniPath | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| transmembrane | transmembrane_predicted | Phobius |
Page 1 of 2Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western BlottingMass Spectrometry | 1 | 36028467 |
Sequence, Structure & Domains
Sequences
Length
165
Mass
19,254
Sequence
MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Motif
88..106; CHIC motif (Cys-rich)
Coiled Coil
1..26
Protein Families
CHIC family
Sequence Similarities
Belongs to the CHIC family.
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No related sentences available |
| 28242843 | Label-free Proteomic Analysis of Exosomes Derived from Inducible Hepatitis B Virus-Replicating HepAD38 Cell Line. | No related sentences available |
| 31320591 | Exosomes regulate neurogenesis and circuit assembly. | No related sentences available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 41201090 | Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma. | No related sentences available |