Protein detail
RAB23
Ras-related protein Rab-23 (EC 3.6.5.2)
Entry name RAB23 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Ras-related protein Rab-23 (EC 3.6.5.2)
Protein Class (3)
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
RAB23, member RAS oncogene family
Chromosome
6
Position
57186992-57222307
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization6
Tissue SpecifickidneyCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificclassical monocyteBlood Lineage SpecificB-cells
Function & Pathway6
Protein Function (3)
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
- Predicted intracellular proteins
Cellular Component (10)
Molecular Function (3)
Biological Process (3)
Reactome (2)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence12
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| RAB23 | Q9ULC3 | SUFU | Q9UMX1 | Yes | Yes | No | SignaLink3 | SignaLink3:22365972 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARFGAP1KPNB1NUP153NUTF2RAB23RANRANBP1RANBP2RANBP3RANGAP1RCC1RGPD3TNPO1UBCXPO1 | A6NKT7O14980P0CG48P18754P43487P46060P49790P49792P61970P62826Q14974Q8N6T3Q92973Q9H6Z4Q9ULC3 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC3654 | ||
| AGKARFGAP1RAB23SNX4UBCZDHHC13 | O95219P0CG48Q53H12Q8IUH4Q8N6T3Q9ULC3 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6239 | ||
| FUZINTURAB23 | Q9BT04Q9ULC3Q9ULD6 | 1:1:1 | PDB | PDB:9rs9 | ||
| GGA1RAB23TNRC6C | Q9HCJ0Q9UJY5Q9ULC3 | 0:0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western BlottingMass Spectrometry | 1 | 36063136 |
Sequence, Structure & Domains13
Sequences
Length
237
Mass
26,659
Sequence
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
3D Structural Models
Turn
152..155
Helix
22..31; 68..70; 72..79; 94..98; 100..110; 123..128; 133..143; 159..170
Beta Strand
7..15; 43..53; 56..64; 84..90; 116..121; 146..149; 156..158
3D Structure
Electron microscopy (1); X-ray crystallography (5)
Domain & Motif Annotations
Compositional Bias
188..208; Polar residues
Motif
28..46; Switch 1; 65..84; Switch 2
Domain (CC)
Switch 1, switch 2 and the interswitch regions are characteristic of Rab GTPases and mediate the interactions with Rab downstream effectors. The switch regions undergo conformational changes upon nucleotide binding which drives interaction with specific sets of effector proteins, with most effectors only binding to GTP-bound Rab.
Region
188..237; Disordered
Protein Families (2)
- Small GTPase superfamily
- Rab family
Sequence Similarities
Belongs to the small GTPase superfamily. Rab family.
Clinical Relevance2
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |