Protein detail

COHA1

Collagen alpha-1(XVII) chain (180 kDa bullous pemphigoid antigen 2) (Bullous pemphigoid antigen 2) [Cleaved into: 120 kDa linear IgA disease antigen (120 kDa linear IgA dermatosis antigen) (Linear IgA disease antigen 1) (LAD-1); 97 kDa linear IgA disease antigen (97 kDa linear IgA bullous dermatosis antigen) (97 kDa LAD antigen) (97-LAD) (Linear IgA bullous disease antigen of 97 kDa) (LABD97)]

Entry name COHA1	UniProt ID Q9UMD9	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 1	Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (7)

Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins

Protein Function (5)

Predicted intracellular proteins
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
Predicted secreted proteins
Disease related genes

Transmembrane

468..488; Helical; Signal-anchor for type II membrane protein

Transmembrane Count

Ensembl

ENSG00000065618

Entrez Gene Symbol

COL17A1

Gene Synonym (2)

BP180BPAG2

Gene Description

Collagen type XVII alpha 1 chain

Chromosome

Position

104031286-104085880

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Cell SpecificEsophageal apical cellsSingle-Nuclei Brain Specificoligodendrocyte precursor cellBlood Cell Specificintermediate monocyte

Function & Pathway7

Protein Function (5)

Predicted intracellular proteins
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
Predicted secreted proteins
Disease related genes

Cellular Component (9)

Molecular Function (3)

Biological Process (3)

KEGG (2)

Reactome (12)

Page 1 of 2

Mediation Categories (3)

Adhesion and uptake mediationImmune mediationReceptor-signaling mediation

Relations & Evidence35

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
COL17A1	CSNK2A1	P68400	S	544	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
COL17A1	CSNK2A1	P68400	S	542	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (29)

29 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
ligand	ligand	CellPhoneDB	Yes	No	Yes	No	No
ligand	ligand	ICELLNET	Yes	No	Yes	No	No
ecm_interaction	ligand	ICELLNET	Yes	No	Yes	No	No
ecm_interaction_col	ligand	ICELLNET	Yes	No	Yes	No	No
ligand	ligand	OmniPath	Yes	No	Yes	No	No
transmembrane	transmembrane_predicted	Phobius	No	No	Yes	No	No
transmembrane_phobius	transmembrane_predicted	Almen2009	No	No	Yes	No	No
transmembrane_sosui	transmembrane_predicted	Almen2009	No	No	Yes	No	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	Yes	No	No

Page 3 of 3Previous

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CSK21	P68400	COHA1	Q9UMD9	Yes	No	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:17545155

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
Collagen type XVII trimer	COL17A1	Q9UMD9	6	ComplexPortalPDB	PDB:8izsintact:EBI-2528731	17876790 14755292 1916105
	COL17A1 DENR FBL MCTS1 UBC	O43583 P0CG48 P22087 Q9ULC4 Q9UMD9	1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7012

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry [LTQ-FT Ultra]Mass spectrometrySmall R sequencing (Illumi HiSeq 2000 (Solexa)	1	27605433

Sequence, Structure & Domains8

Sequences

Length

1,497

Mass

150,419

Sequence

MDVTKKNKRDGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTRHAYEGSSSGNSSPEYPRKEFASSSTRGRSQTRESEIRVRLQSASPSTRWTELDDVKRLLKGSRSASVSPTRNSSNTLPIPKKGTVETKIVTASSQSVSGTYDATILDANLPSHVWSSTLPAGSSMGTYHNNMTTQSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGLSTSSSVFGMQNNLAPSLTTLSHGTTTTSTAYGVKKNMPQSPAAVNTGVSTSAACTTSVQSDDLLHKDCKFLILEKDNTPAKKEMELLIMTKDSGKVFTASPASIAATSFSEDTLKKEKQAAYNADSGLKAEANGDLKTVSTKGKTTTADIHSYGSSGGGGSGGGGGVGGAGGGPWGPAPAWCPCGSCCSWWKWLLGLLLTWLLLLGLLFGLIALAEEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGLHSDSQEELWMFVRKKLMMEQENGNLRGSPGPKGDMGSPGPKGDRGFPGTPGIPGPLGHPGPQGPKGQKGSVGDPGMEGPMGQRGREGPMGPRGEAGPPGSGEKGERGAAGEPGPHGPPGVPGSVGPKGSSGSPGPQGPPGPVGLQGLRGEVGLPGVKGDKGPMGPPGPKGDQGEKGPRGLTGEPGMRGLPGAVGEPGAKGAMGPAGPDGHQGPRGEQGLTGMPGIRGPPGPSGDPGKPGLTGPQGPQGLPGTPGRPGIKGEPGAPGKIVTSEGSSMLTVPGPPGPPGAMGPPGPPGAPGPAGPAGLPGHQEVLNLQGPPGPPGPRGPPGPSIPGPPGPRGPPGEGLPGPPGPPGSFLSNSETFLSGPPGPPGPPGPKGDQGPPGPRGHQGEQGLPGFSTSGSSSFGLNLQGPPGPPGPQGPKGDKGDPGVPGALGIPSGPSEGGSSSTMYVSGPPGPPGPPGPPGSISSSGQEIQQYISEYMQSDSIRSYLSGVQGPPGPPGPPGPVTTITGETFDYSELASHVVSYLRTSGYGVSLFSSSISSEDILAVLQRDDVRQYLRQYLMGPRGPPGPPGASGDGSLLSLDYAELSSRILSYMSSSGISIGLPGPPGPPGLPGTSYEELLSLLRGSEFRGIVGPPGPPGPPGIPGNVWSSISVEDLSSYLHTAGLSFIPGPPGPPGPPGPRGPPGVSGALATYAAENSDSFRSELISYLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9UMD9-1; Sequence=Displayed; Name=2; IsoId=Q9UMD9-2; Sequence=VSP_024940, VSP_024941

Alternative Sequence

922..966; Missing (in isoform 2); 1170..1207; GSEFRGIVGPPGPPGPPGIPGNVWSSISVEDLSSYLHT -> A (in isoform 2)

3D Structural Models

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

9..19; Basic and acidic residues; 57..96; Polar residues; 169..183; Polar residues; 590..602; Pro residues; 604..635; Low complexity; 661..673; Low complexity; 735..748; Low complexity; 774..796; Low complexity; 820..841; Pro residues; 858..881; Pro residues; 907..916; Pro residues; 936..946; Low complexity; 968..987; Low complexity; 994..1004; Pro residues; 1214..1228; Pro residues; 1266..1275; Pro residues; 1289..1312; Low complexity; 1458..1469; Pro residues; 1472..1481; Basic and acidic residues; 1486..1497; Basic residues

Region

1..566; Nonhelical region (NC16); 1..154; Disordered; 145..230; Necessary for interaction with DST and for the recruitment of DST to hemidesmosome; 167..186; Disordered; 562..1011; Disordered; 567..1482; Triple-helical region; 1209..1234; Disordered; 1261..1316; Disordered; 1434..1497; Disordered; 1483..1497; Nonhelical region (NC1)

Clinical Relevance3

Disease Involvement (3)

Cancer-related genesDisease variantEpidermolysis bullosa

Drugs

ASPIRIN

Antibody (2)

HPA043673 HPA052963

Supporting Publications1

PMID	Title	Abstract
30805606	Ionizing radiation affects the composition of the proteome of extracellular vesicles released by head-and-neck cancer cells in vitro.	No abstract available