Protein detail
RIMS2
Regulating synaptic membrane exocytosis protein 2 (Rab-3-interacting molecule 2) (RIM 2) (Rab-3-interacting protein 3)
Entry name RIMS2 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Regulating synaptic membrane exocytosis protein 2 (Rab-3-interacting molecule 2) (RIM 2) (Rab-3-interacting protein 3)
Protein Class (3)
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Eye disease
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
KIAA0751OBOERAB3IP3RIM2
Gene Description
Regulating synaptic membrane exocytosis 2
Chromosome
8
Position
103500610-104254430
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificintestineBrain Regional Specificchoroid plexusCell SpecificAlveolar cells type 1Single-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Eye disease
Cellular Component (5)
Molecular Function (5)
Biological Process (3)
- GO:0002486 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent
- GO:0002476 antigen processing and presentation of endogenous peptide antigen via MHC class Ib
- GO:0002484 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence22
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RIMS2 | RPS6KA3 | P51812 | S | 409 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | GO_Intercell | Yes | Yes | |||
| ecm | ecm | OmniPath | Yes | Yes | |||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| secreted | secreted | Cellinker | Yes | ||||
| secreted | secreted | OmniPath | Yes |
Regulatory Interaction Network (9)
9 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| RIMS2 | Q9UQ26 | RAB3C | Q96E17 | Yes | Yes | HPRDSIGNOR | SIGNOR:31679900HPRD:12578829 | |
| RIMS2 | Q9UQ26 | RAB3A | P20336 | Yes | Yes | HPRDSIGNOR | SIGNOR:31679900HPRD:12578829 | |
| RIMS2 | Q9UQ26 | UN13B | O14795 | Yes | Yes | SIGNOR | SIGNOR:31679900 | |
| RIMB2 | O15034 | RIMS2 | Q9UQ26 | Yes | Yes | LMPIDSIGNOR | LMPID:11988172SIGNOR:11988172LMPID:10748113 | |
| RIMS2 | Q9UQ26 | CAC1D | Q01668 | Yes | Yes | SIGNOR | SIGNOR:28642685 | |
| RIM3B | A6NNM3 | RIMS2 | Q9UQ26 | Yes | Yes | SIGNOR | SIGNOR:11988172 | |
| RIMB1 | O95153 | RIMS2 | Q9UQ26 | Yes | Yes | LMPIDSIGNOR | LMPID:11988172SIGNOR:11988172LMPID:10748113 | |
| RIM3A | Q9UFD9 | RIMS2 | Q9UQ26 | Yes | Yes | SIGNOR | SIGNOR:11988172 | |
| RIM3C | A6NJZ7 | RIMS2 | Q9UQ26 | Yes | Yes | SIGNOR | SIGNOR:11988172 |
Protein Complex Composition (2)
2 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Rab3a-Rims2-Rapgef4 complex | RAB3ARAB3CRAPGEF3RAPGEF4RIMS2 | O95398P20336Q8WZA2Q96E17Q9UQ26 | 1:1:1:1:1 | Compleat | Compleat:HC3320 | 11056535 |
| RAB3CRAB3DRIMS2RPH3AL | O95716Q96E17Q9UNE2Q9UQ26 | 1:1:1:1 | CompleatCFinder | Compleat:HC9715 |
Sequence, Structure & Domains
Sequences
Length
1,411
Mass
160,403
Sequence
MSAPVGPRGRLAPIPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKKVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQQQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQQPDQKVLRGLRNEEAPQEKKPKLHEQTQFQGPSGDLSVPAVEKSRSHGLTRQHSIKNGSGVKHHIASDIASDRKRSPSVSRDQNRRYDQREEREEYSQYATSDTAMPRSPSDYADRRSQHEPQFYEDSDHLSYRDSNRRSHRHSKEYIVDDEDVESRDEYERQRREEEYQSRYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANADLEDSRISMLRMDRPSRQRSISERRAAMENQRSYSMERTREAQGPSSYAQRTTNHSPPTPRRSPLPIDRPDLRRTDSLRKQHHLDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPPKPHKSKKGGKMRQISLSSSEEELASTPEYTSCDDVEIESESVSEKGDSQKGKRKTSEQAVLSDSNTRSERQKEMMYFGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHDVSSLPLPHPSPYMPRRQLHGESPTRRLQRSKRISDSEVSDYDCDDGIGVVSDYRHDGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDVIGRTRSWSPSVPPPQSRNVEQGLRGTRTMTGHYNTISRMDRHRVMDDHYSPDRDRDCEAADRQPYHRSRSTEQRPLLERTTTRSRSTERPDTNLMRSMPSLMTGRSAPPSPALSRSHPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLDRKAGGKKLRSTVQRSTETGLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSLESSTGPSYSRS
Alternative Products
Event=Alternative splicing; Named isoforms=8; Name=6; Synonyms=RIM2-alpha; IsoId=Q9UQ26-6; Sequence=Displayed; Name=1; Synonyms=RIM2-beta; IsoId=Q9UQ26-1; Sequence=VSP_040865, VSP_040866; Name=2; IsoId=Q9UQ26-2; Sequence=VSP_040872, VSP_040873; Name=3; IsoId=Q9UQ26-3; Sequence=VSP_040865, VSP_040866, VSP_040867, VSP_040874; Name=4; Synonyms=RimL3a; IsoId=Q9UQ26-4; Sequence=VSP_040868, VSP_040871; Name=5; Synonyms=RimL3c; IsoId=Q9UQ26-5; Sequence=VSP_040869, VSP_040870; Name=7; Synonyms=RIM2-gamma; IsoId=Q9UQ26-7; Sequence=VSP_040864, VSP_040875; Name=8; IsoId=Q9UQ26-8; Sequence=VSP_044661, VSP_040867, VSP_044662
Alternative Sequence
1..1126; Missing (in isoform 7); 1..223; Missing (in isoform 1 and isoform 3); 50..90; KVKEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQT -> EEEKEQSVLK (in isoform 8); 224..263; SGDLSVPAVEKSRSHGLTRQHSIKNGSGVKHHIASDIASD -> MQFETLRQVCNSVLSHFHGVFSSPPNILQNELFGQTLNNA (in isoform 1 and isoform 3); 575..642; SQKGKRKTSEQAVLSDSNTRSERQKEMMYFGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDK -> MDYNWLDHTSWHSSEASPMSL (in isoform 3 and isoform 8); 774..801; SSSFESQKMDRPSISVTSPMSPGMLRDV -> KFYLCWKKTLFIIAFIRDQMKYLTSNVK (in isoform 4); 802..1411; Missing (in isoform 4); 810; S -> SSQSLSRRTTPFVPRVQ (in isoform 8); 811..824; IKLWFDKVGHQLIV -> VCSHYVYSSFWNIK (in isoform 5); 825..1411; Missing (in isoform 5); 1038; S -> R (in isoform 2); 1039..1411; Missing (in isoform 2); 1076; D -> DSHFLTLPRSRYSQTIDHHHRDG (in isoform 3); 1127..1174; RSAPPSPALSRSHPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLDRK -> MGRQGLGGASAAGRSMQRSQSRSSLSASFEALAGYFPCMNSLEEEEGE (in isoform 7)
3D Structural Models
Turn
677..680; 817..820
Helix
706..710; 732..741; 885..887; 916..918
Beta Strand
646..649; 651..663; 681..688; 690..692; 694..701; 718..722; 743..754; 808..816; 821..831; 836..838; 843..846; 854..857; 890..898; 900..903; 910..915; 925..929
3D Structure
NMR spectroscopy (2)
Domain & Motif Annotations
Compositional Bias
203..216; Basic and acidic residues; 273..287; Basic and acidic residues; 318..329; Basic and acidic residues; 348..366; Basic and acidic residues; 382..401; Basic and acidic residues; 410..434; Basic and acidic residues; 451..463; Polar residues; 475..492; Basic and acidic residues; 510..521; Polar residues; 528..537; Basic residues; 558..568; Acidic residues; 569..583; Basic and acidic residues; 634..644; Basic and acidic residues; 994..1015; Polar residues; 1049..1059; Polar residues; 1060..1113; Basic and acidic residues; 1143..1153; Polar residues
Zinc Finger
117..173; FYVE-type
Domain (FT)
26..185; RabBD; 668..754; PDZ; 805..928; C2 1; 1257..1375; C2 2
Region
1..33; Disordered; 203..598; Disordered; 623..650; Disordered; 762..793; Disordered; 939..973; Disordered; 993..1190; Disordered
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 31414377 | Global extracellular vesicle proteomic signature defines U87-MG glioma cell hypoxic status with potential implications for non-invasive diagnostics. | No related sentences available |