Protein detail
CLTR1
Cysteinyl leukotriene receptor 1 (CysLTR1) (Cysteinyl leukotriene D4 receptor) (LTD4 receptor) (G-protein coupled receptor HG55) (HMTMF81)
Entry name CLTR1 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification FDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Cysteinyl leukotriene receptor 1 (CysLTR1) (Cysteinyl leukotriene D4 receptor) (LTD4 receptor) (G-protein coupled receptor HG55) (HMTMF81)
Protein Class (4)
FDA approved drug targetsG-protein coupled receptorsPredicted membrane proteinsTransporters
Protein Function (3)
- Transporters
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
29..49; Helical; Name=1; 58..78; Helical; Name=2; 107..127; Helical; Name=3; 142..162; Helical; Name=4; 194..214; Helical; Name=5; 231..251; Helical; Name=6; 277..297; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
CysLT(1)CysLT1CYSLT1R
Gene Description
Cysteinyl leukotriene receptor 1
Chromosome
X
Position
78271468-78327691
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization1
Cell SpecificEpicardial cells
Function & Pathway7
Protein Function (3)
- Transporters
- FDA approved drug targets:Small molecule drugs
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Reactome (13)
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-391903 eicosanoid ligand binding receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-416476 g alpha q signalling events
- R-hsa-5663205 infectious disease
- R-hsa-9658195 leishmania infection
- R-hsa-391906 leukotriene receptors
- R-hsa-9664535 ltc4 cysltr mediated il4 production
- R-hsa-9679191 potential therapeutics for sars
Page 1 of 2
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence55
Enzyme-Mediated Modification (3)
Ligand-Receptor Signaling (44)
44 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cysteinyl_leukotriene_ebv_induced_platelet_activating_factor_7tm_a | receptor | HPMR | No | Yes | No | Yes | No |
| rhodopsin | receptor | Surfaceome | No | Yes | No | Yes | No |
| gpcr | receptor | Surfaceome | No | Yes | No | Yes | No |
| class_a_rhodopsin | receptor | GPCRdb | No | Yes | No | Yes | No |
| class_a_rhodopsin_lipid | receptor | GPCRdb | No | Yes | No | Yes | No |
| class_a_rhodopsin_lipid_leukotriene | receptor | GPCRdb | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CLTR1 | Q9Y271 | GNAI1 | P63096 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| CLTR1 | Q9Y271 | GNAQ | P50148 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| CLTR1 | Q9Y271 | GNAI3 | P08754 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| CLTR1 | Q9Y271 | GNA14 | O95837 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| CLTR1 | Q9Y271 | GNA15 | P30679 | Yes | Yes | No | WangSIGNOR | SIGNOR:31160049 |
| KPCA | P17252 | CLTR1 | Q9Y271 | Yes | No | No | PhosphoSite_norefPhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:22230957 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | Western blotting | 1 | 40098346 |
Sequence, Structure & Domains8
Sequences
Length
337
Mass
38,541
Sequence
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
3D Structural Models
Turn
85..87; 128..130
Helix
18..49; 57..73; 76..84; 92..126; 131..134; 137..154; 156..158; 184..197; 199..222; 227..244; 246..259; 267..285; 286..289; 290..298
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance9
Disease Involvement
FDA approved drug targets
Related Diseases (4)
Biomarker
Phase 1; Approved; Discontinued in Phase 2; Phase 3
Drug Targets
FDA approved drug targets
Drugs (12)
Antibody
Interaction Protein
ENSG00000152207
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 30550287 | Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes. | No abstract available |