Protein detail
COF2
Cofilin-2 (Cofilin, muscle isoform)
Entry name COF2 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 3 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Cofilin-2 (Cofilin, muscle isoform)
Protein Class (4)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Musculoskeletal diseases:Muscular diseases
Ensembl
Entrez Gene Symbol
Gene Synonym
NEM7
Gene Description
Cofilin 2
Chromosome
14
Position
34709113-34714823
Supporting publications (n)
3
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue Specificchoroid plexusBrain Regional Specificchoroid plexusCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway6
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Musculoskeletal diseases:Muscular diseases
Cellular Component (7)
Molecular Function (2)
Biological Process (3)
KEGG (5)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence28
Enzyme-Mediated Modification (11)
11 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CFL2 | LIMK1 | P53667 | S | 3 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapper | HPRD:19413330KEA:9655398HPRD:9655398HPRD:19651622HPRD:20068231KEA:12684437ProtMapper:9655398KEA:17081983KEA:8824278HPRD:8824278HPRD:12684437phosphoELM:9655398 |
| CFL2 | LIMK1 | P53667 | S | 24 | phosphorylation | NCI-PID_ProtMapperProtMapper | |
| CFL2 | SSH1 | Q8WYL5 | S | 3 | dephosphorylation | HPRD | HPRD:12684437 |
| CFL2 | EGF | P01133 | S | 3 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| CFL2 | TESK2 | Q96S53 | S | 3 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:11418599 |
| CFL2 | TESK1 | Q15569 | S | 3 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:11418599 |
| CFL2 | CAMK2A | Q9UQM7 | S | 24 | phosphorylation | KEA | KEA:9677407 |
| CFL2 | CAMK2B | Q13554 | S | 24 | phosphorylation | KEA | KEA:9677407 |
| CFL2 | CAMK2D | Q13557 | S | 24 | phosphorylation | KEA | KEA:9677407 |
| CFL2 | CAMK2G | Q13555 | S | 24 | phosphorylation | KEA | KEA:9677407 |
Page 1 of 2Next
Ligand-Receptor Signaling (8)
8 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| extracellular | extracellular | OmniPath | No | No | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LIMK1 | P53667 | COF2 | Q9Y281 | Yes | Yes | Yes | KEGG-MEDICUSHPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEANCI-PID_ProtMapperHPRDCui2007WangHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperSPIKE_LCSPIKE | ProtMapper:9655398KEA:8824278ProtMapper:19413330SIGNOR:9655398ProtMapper:12684437HPRD-phos:9655398HPRD-phos:8824278KEA:17081983HPRD-phos:20068231HPRD:12684437KEA:12684437ProtMapper:19651622phosphoELM:9655398KEA:9655398HPRD:9655398SPIKE_LC:8079118SPIKE:8079118ProtMapper:20068231ProtMapper:8824278HPRD:8824278HPRD-phos:19413330HPRD-phos:12684437HPRD-phos:19651622 |
| TESK2 | Q96S53 | COF2 | Q9Y281 | Yes | No | Yes | SIGNOR_ProtMapperiPTMnetSIGNORProtMapper | SIGNOR:11418599ProtMapper:11418599 |
| TESK1 | Q15569 | COF2 | Q9Y281 | Yes | No | Yes | SIGNOR_ProtMapperiPTMnetSIGNORProtMapper | SIGNOR:11418599ProtMapper:11418599 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ATP5IF1CFL2ECH1ECI2MRI1 | O75521Q13011Q9BV20Q9UII2Q9Y281 | 0:0:0:0:0 | hu.MAP2 | |||
| ANXA7CFL2 | P20073Q9Y281 | 0:0 | hu.MAP2 | |||
| CFL2EIF4A2EIF4G1LIMK1NRG1 | P53667Q02297Q04637Q14240Q9Y281 | 1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7566 | ||
| CFL2PPA1 | Q15181Q9Y281 | 0:0 | Havugimana2012 | Havugimana2012:C_16 | ||
| CFL2TKTL2 | Q9H0I9Q9Y281 | 0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 1 | 37759206 |
Sequence, Structure & Domains14
Sequences
Length
166
Mass
18,737
Sequence
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Comment=Isoforms are identical at the level of the protein sequence.; Name=CFL2b; IsoId=Q9Y281-1; Sequence=Displayed; Name=CFL2a; IsoId=Q9Y281-2; Sequence=Not described; Name=3; IsoId=Q9Y281-3; Sequence=VSP_046831
Alternative Sequence
1..17; Missing (in isoform 3)
3D Structural Models
Turn
24..27; 61..63
Helix
9..11; 12..19; 28..31; 57..60; 68..74; 111..127; 140..144; 146..153
Beta Strand
37..40; 44..49; 77..79; 81..90; 95..104; 130..137; 158..161
3D Structure
NMR spectroscopy (2)
Domain & Motif Annotations
Motif
30..34; Nuclear localization signal
Domain (FT)
4..153; ADF-H
Region
2..55; Interaction with CSRP3; 55..105; Interaction with CSRP3
Protein Families
Actin-binding proteins ADF family
Sequence Similarities
Belongs to the actin-binding proteins ADF family.
Clinical Relevance5
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33204424 | Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid. | No abstract available |