Protein detail

COF2

Cofilin-2 (Cofilin, muscle isoform)

Entry name COF2	UniProt ID Q9Y281	EVMP score 0.38
Frequency 3	Transmembrane count	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Cofilin-2 (Cofilin, muscle isoform)

Protein Class

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins

Protein Function

Disease related genes
Predicted intracellular proteins
Human disease related genes:Musculoskeletal diseases:Muscular diseases

Ensembl

ENSG00000165410

Entrez Gene Symbol

CFL2

Gene Synonym

NEM7

Gene Description

Cofilin 2

Chromosome

Position

34709113-34714823

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue Specificchoroid plexusBrain Regional Specificchoroid plexusCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell

Function & Pathway

Protein Function

Disease related genes
Predicted intracellular proteins
Human disease related genes:Musculoskeletal diseases:Muscular diseases

Cellular Component

Molecular Function

Biological Process

KEGG

Mediation Categories

Fusion and delivery mediation

Relations & Evidence

Enzyme-Mediated Modification

11 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
CFL2	LIMK1	P53667	S	3	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapper	HPRD:19413330 KEA:9655398 HPRD:9655398 HPRD:19651622 HPRD:20068231 KEA:12684437 ProtMapper:9655398 KEA:17081983 KEA:8824278 HPRD:8824278 HPRD:12684437 phosphoELM:9655398
CFL2	LIMK1	P53667	S	24	phosphorylation	NCI-PID_ProtMapperProtMapper
CFL2	SSH1	Q8WYL5	S	3	dephosphorylation	HPRD	HPRD:12684437
CFL2	EGF	P01133	S	3	phosphorylation	BEL-Large-Corpus_ProtMapperProtMapper	ProtMapper:17081983
CFL2	TESK2	Q96S53	S	3	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:11418599
CFL2	TESK1	Q15569	S	3	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:11418599
CFL2	CAMK2A	Q9UQM7	S	24	phosphorylation	KEA	KEA:9677407
CFL2	CAMK2B	Q13554	S	24	phosphorylation	KEA	KEA:9677407
CFL2	CAMK2D	Q13557	S	24	phosphorylation	KEA	KEA:9677407
CFL2	CAMK2G	Q13555	S	24	phosphorylation	KEA	KEA:9677407

Page 1 of 2Next

Ligand-Receptor Signaling

8 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
ecm	ecm	MatrixDB	Yes	No	No	No	No
ecm	ecm	OmniPath	Yes	No	No	No	No
extracellular	extracellular	OmniPath	No	No	No	No	No
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LIMK1	P53667	COF2	Q9Y281	Yes	Yes	Yes	KEGG-MEDICUSHPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEANCI-PID_ProtMapperHPRDCui2007WangHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperSPIKE_LCSPIKE	ProtMapper:9655398 KEA:8824278 ProtMapper:19413330 SIGNOR:9655398 ProtMapper:12684437 HPRD-phos:9655398 HPRD-phos:8824278 KEA:17081983 HPRD-phos:20068231 HPRD:12684437 KEA:12684437 ProtMapper:19651622 phosphoELM:9655398 KEA:9655398 HPRD:9655398 SPIKE_LC:8079118 SPIKE:8079118 ProtMapper:20068231 ProtMapper:8824278 HPRD:8824278 HPRD-phos:19413330 HPRD-phos:12684437 HPRD-phos:19651622
TESK2	Q96S53	COF2	Q9Y281	Yes	No	Yes	SIGNOR_ProtMapperiPTMnetSIGNORProtMapper	SIGNOR:11418599 ProtMapper:11418599
TESK1	Q15569	COF2	Q9Y281	Yes	No	Yes	SIGNOR_ProtMapperiPTMnetSIGNORProtMapper	SIGNOR:11418599 ProtMapper:11418599

Protein Complex Composition

5 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ATP5IF1 CFL2 ECH1 ECI2 MRI1	O75521 Q13011 Q9BV20 Q9UII2 Q9Y281	0:0:0:0:0	hu.MAP2
ANXA7 CFL2	P20073 Q9Y281	0:0	hu.MAP2
CFL2 EIF4A2 EIF4G1 LIMK1 NRG1	P53667 Q02297 Q04637 Q14240 Q9Y281	1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7566
CFL2 PPA1	Q15181 Q9Y281	0:0	Havugimana2012	Havugimana2012:C_16
CFL2 TKTL2	Q9H0I9 Q9Y281	0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry [LTQ-FT Ultra]Mass spectrometry	1	37759206

Sequence, Structure & Domains

Sequences

Length

166

Mass

18,737

Sequence

MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

Alternative Products

Event=Alternative splicing; Named isoforms=3; Comment=Isoforms are identical at the level of the protein sequence.; Name=CFL2b; IsoId=Q9Y281-1; Sequence=Displayed; Name=CFL2a; IsoId=Q9Y281-2; Sequence=Not described; Name=3; IsoId=Q9Y281-3; Sequence=VSP_046831

Alternative Sequence

1..17; Missing (in isoform 3)

3D Structural Models

Turn

24..27; 61..63

Helix

9..11; 12..19; 28..31; 57..60; 68..74; 111..127; 140..144; 146..153

Beta Strand

37..40; 44..49; 77..79; 81..90; 95..104; 130..137; 158..161

3D Structure

NMR spectroscopy (2)

Domain & Motif Annotations

Motif

30..34; Nuclear localization signal

Domain (FT)

4..153; ADF-H

Region

2..55; Interaction with CSRP3; 55..105; Interaction with CSRP3

Protein Families

Actin-binding proteins ADF family

Sequence Similarities

Belongs to the actin-binding proteins ADF family.

Clinical Relevance

Disease Involvement

Disease variantNemaline myopathy

Antibody

CAB037078 HPA045599 HPA077782

Interaction Protein

ENSG00000075624ENSG00000125868ENSG00000172757ENSG00000184009

Interaction Count

Interaction Dataset

intact_biogrid_opencellintact_biogridintact_biogrid_bioplex