Protein detail
SIGL7
Sialic acid-binding Ig-like lectin 7 (Siglec-7) (Adhesion inhibitory receptor molecule 1) (AIRM-1) (CDw328) (D-siglec) (QA79 membrane protein) (p75) (CD antigen CD328)
Entry name SIGL7 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sialic acid-binding Ig-like lectin 7 (Siglec-7) (Adhesion inhibitory receptor molecule 1) (AIRM-1) (CDw328) (D-siglec) (QA79 membrane protein) (p75) (CD antigen CD328)
Protein Class (3)
CD markersPredicted intracellular proteinsPredicted membrane proteins
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Transmembrane
354..376; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
CD328p75/AIRM1QA79SIGLEC-7SIGLEC19PSIGLECP2
Gene Description
Sialic acid binding Ig like lectin 7
Chromosome
19
Position
51142299-51153526
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Blood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Cellular Component
Molecular Function (4)
Biological Process (3)
Reactome (2)
Mediation Categories
Immune mediation
Relations & Evidence25
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ig_like | adhesion | Almen2009 | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane_predicted | transmembrane | OmniPath | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes |
Page 1 of 3Next
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| COMPLEX:Q15369_Q15370_Q93034_Q9UBF6 | SIGL7 | Q9Y286 | Yes | Yes | SIGNOR | SIGNOR:17138568 | ||
| SOCS3 | O14543 | SIGL7 | Q9Y286 | Yes | Yes | InnateDBSIGNOR | InnateDB:17138568SIGNOR:17138568 |
Sequence, Structure & Domains
Sequences
Length
467
Mass
51,143
Sequence
MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDSNPPARLSWTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSGVLLGAVGGAGATALVFLSFCVIFIVVRSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPRHHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIPK
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=AIRM-1b; IsoId=Q9Y286-1; Sequence=Displayed; Name=2; Synonyms=AIRM-2; IsoId=Q9Y286-2; Sequence=VSP_002555; Name=3; Synonyms=AIRM-3; IsoId=Q9Y286-3; Sequence=VSP_002556, VSP_002558; Name=4; IsoId=Q9Y286-4; Sequence=VSP_002557, VSP_002558
Alternative Sequence
145..238; ALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSY -> D (in isoform 2); 145; A -> E (in isoform 3); 145; A -> G (in isoform 4); 146..467; Missing (in isoform 3 and isoform 4)
3D Structural Models
Turn
54..58; 92..94
Helix
23..25; 72..74; 85..88; 89..91; 101..103; 115..117
Beta Strand
27..30; 32..37; 42..44; 46..49; 62..67; 69..71; 78..81; 95..97; 108..110; 119..127; 130..133; 139..144
3D Structure
X-ray crystallography (6)
Domain & Motif Annotations
Compositional Bias
401..412; Polar residues; 450..460; Polar residues
Motif
435..440; ITIM motif
Domain (CC)
Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
Domain (FT)
39..122; Ig-like V-type; 150..233; Ig-like C2-type 1; 240..336; Ig-like C2-type 2
Region
401..431; Disordered; 443..467; Disordered
Protein Families (2)
- Immunoglobulin superfamily
- SIGLEC (sialic acid binding Ig-like lectin) family
Sequence Similarities
Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 15326289 | Identification and proteomic profiling of exosomes in human urine. | No related sentences available |