Protein detail
ITM2B
Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)]
Entry name ITM2B | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 16 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)]
Protein Class (7)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function (7)
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Human disease related genes:Congenital malformations:Congenital malformations of eye
- Potential drug targets
- Transporters:Transporter channels and pores
- Predicted secreted proteins
- Disease related genes
Transmembrane
55..75; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
BRIBRI2BRICD2BE25BE3-16
Gene Description
Integral membrane protein 2B
Chromosome
13
Position
48232612-48270357
Supporting publications (n)
16
EVMP confidence score
0.47
Fluorescence & Localization5
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificneutrophil
Function & Pathway6
Protein Function (7)
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Human disease related genes:Congenital malformations:Congenital malformations of eye
- Potential drug targets
- Transporters:Transporter channels and pores
- Predicted secreted proteins
- Disease related genes
Cellular Component (11)
- GO:0000139 Golgi membrane
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0010008 endosome membrane
- GO:0016020 membrane
- GO:0030660 Golgi-associated vesicle membrane
- GO:0031090 organelle membrane
- GO:0043231 intracellular membrane-bounded organelle
Page 1 of 2
Molecular Function (3)
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence32
Ligand-Receptor Signaling (29)
29 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | Yes | Yes | No |
| ecm | ecm | OmniPath | Yes | No | Yes | Yes | No |
| extracellular | extracellular | OmniPath | No | No | Yes | Yes | No |
| intracellular | intracellular | ComPPI | No | No | Yes | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | Yes | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | Yes | No |
| intracellular | intracellular | OmniPath | No | No | Yes | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | Yes | No |
Page 1 of 3Next
Protein Complex Composition (2)
Sequence, Structure & Domains13
Sequences
Length
266
Mass
30,338
Sequence
MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y287-1; Sequence=Displayed; Name=2; IsoId=Q9Y287-2; Sequence=VSP_055326
Alternative Sequence
83..188; Missing (in isoform 2)
3D Structural Models
Turn
123..126; 149..152; 159..162
Helix
180..185; 217..222
Beta Strand
118..122; 127..132; 136..139; 143..148; 153..156; 164..168; 227..230
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Domain (FT)
137..231; BRICHOS
Region
102..134; Necessary for interaction with APP and inhibitor effects on APP processing
Protein Families
ITM2 family
Sequence Similarities
Belongs to the ITM2 family.
Clinical Relevance2
Supporting Publications16
| PMID | Title | Abstract |
|---|---|---|
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No abstract available |
| 32916986 | Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines. | No abstract available |
| 33304478 | The proteomic landscape of small urinary extracellular vesicles during kidney transplantation. | No abstract available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No abstract available |
| 36064647 | Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells. | No abstract available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |
| 36982312 | Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis. | No abstract available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No abstract available |
| 37670049 | Proteomic and functional characterisation of extracellular vesicles from collagen VI deficient human fibroblasts reveals a role in cell motility. | No abstract available |
| 37926756 | Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells. | No abstract available |
Page 1 of 2Next