Protein detail
ITM2B
Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)]
Entry name ITM2B | UniProt ID | EVMP score 0.47 |
Frequency 16 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)]
Protein Class
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Human disease related genes:Congenital malformations:Congenital malformations of eye
- Potential drug targets
- Transporters:Transporter channels and pores
- Predicted secreted proteins
- Disease related genes
Transmembrane
55..75; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
BRIBRI2BRICD2BE25BE3-16
Gene Description
Integral membrane protein 2B
Chromosome
13
Position
48232612-48270357
Frequency
16
EVMP Score
0.47
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificneutrophil
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Human disease related genes:Congenital malformations:Congenital malformations of eye
- Potential drug targets
- Transporters:Transporter channels and pores
- Predicted secreted proteins
- Disease related genes
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0010008 endosome membrane
- GO:0016020 membrane
- GO:0030660 Golgi-associated vesicle membrane
- GO:0031090 organelle membrane
- GO:0043231 intracellular membrane-bounded organelle
- GO:0070062 extracellular exosome
Mediation Categories
Fusion and delivery mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
29 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | Yes | No |
| secreted | secreted | OmniPath | No | No | Yes | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | Yes | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | Yes | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | Yes | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | Yes | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | Yes | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | Yes | Yes | No |
Page 3 of 3Previous
Regulatory Interaction Network
0 records.
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
266
Mass
30,338
Sequence
MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y287-1; Sequence=Displayed; Name=2; IsoId=Q9Y287-2; Sequence=VSP_055326
Alternative Sequence
83..188; Missing (in isoform 2)
3D Structural Models
Turn
123..126; 149..152; 159..162
Helix
180..185; 217..222
Beta Strand
118..122; 127..132; 136..139; 143..148; 153..156; 164..168; 227..230
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Domain (FT)
137..231; BRICHOS
Region
102..134; Necessary for interaction with APP and inhibitor effects on APP processing
Protein Families
ITM2 family
Sequence Similarities
Belongs to the ITM2 family.