Protein detail
NTNG1
Netrin-G1 (Laminet-1)
Entry name NTNG1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Netrin-G1 (Laminet-1)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization4
Tissue Specificblood vesselCell SpecificDecidual stromal cellsSingle-Nuclei Brain Specificfibroblast
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
Reactome (2)
Mediation Categories (2)
Adhesion and uptake mediationMetabolism mediation
Relations & Evidence20
Ligand-Receptor Signaling (17)
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | No | No | Yes | No | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | OmniPath | No | No | Yes | No | Yes |
| secreted | secreted | connectomeDB2020 | No | No | Yes | No | Yes |
| secreted | secreted | OmniPath | No | No | Yes | No | Yes |
| cell_surface | cell_surface | Surfaceome | No | No | Yes | No | Yes |
| cell_surface | cell_surface | OmniPath | No | No | Yes | No | Yes |
| glycoprotein | ecm | Matrisome | Yes | No | Yes | No | Yes |
Page 2 of 2Previous
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| NTNG1 | Q9Y2I2 | LRC4C | Q9HCJ2 | Yes | Yes | No | iTALKSIGNORHINTLit-BM-17HPMR_talklrHPMRHPRD_LRdbtalklrHPRDIntActWangRamilowski2015HPMR_LRdbHPRD_talklrBioGRIDSTRING_talklrFantom5_LRdbCellTalkDBconnectomeDB2020LRdb | BioGRID:21946559HPRD:14595443Lit-BM-17:21946559IntAct:21946559SIGNOR:19467332CellTalkDB:14595443HINT:21946559HPMR:14595443connectomeDB2020:14595443HINT:14595443LRdb:14595443Lit-BM-17:14595443 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains12
Sequences
Length
539
Mass
60,541
Sequence
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=3; Synonyms=1A; IsoId=Q9Y2I2-3; Sequence=Displayed; Name=2; Synonyms=1F; IsoId=Q9Y2I2-2; Sequence=VSP_010429, VSP_010430; Name=1; Synonyms=1C; IsoId=Q9Y2I2-1; Sequence=VSP_012574, VSP_012579; Name=4; Synonyms=1D; IsoId=Q9Y2I2-4; Sequence=VSP_012575; Name=5; Synonyms=1E; IsoId=Q9Y2I2-5; Sequence=VSP_012576, VSP_012577; Name=6; Synonyms=1G; IsoId=Q9Y2I2-6; Sequence=VSP_012578, VSP_012580
Alternative Sequence
363..463; Missing (in isoform 1); 363..364; NC -> SK (in isoform 2); 364..464; CECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQP -> PPKFNRIWPNISSLEVSNPKQVAPKLALSTVSSVQVANHKRA (in isoform 4); 364..385; CECFGHSNRCSYIDLLNTVICV -> PPKFNRIWPNISSLEVSNPKQA (in isoform 5); 365..539; Missing (in isoform 2); 386..464; Missing (in isoform 5); 419..463; Missing (in isoform 6); 464; P -> T (in isoform 1); 464; P -> A (in isoform 6)
3D Structural Models
Turn
97..99; 209..211; 216..219
Helix
57..59; 68..70; 103..107; 182..185; 193..195; 226..233; 240..249; 251..256; 281..283
Beta Strand
33..36; 45..48; 62..67; 94..96; 118..120; 132..144; 148..154; 158..167; 173..181; 213..215; 220..223; 257..268; 272..275; 287..292; 294..297; 300..302; 306..309; 312..315; 321..326; 345..348
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (CC)
The laminin N-terminal domain mediates 1:1 binding to NGL ligand with sub-micromolar affinity. Three NGL-binding loops mediate discrimination for LRRC4C/NGL1 among other NGLs by binding specifically to its LRR repeats. This specificity drives the sorting of a mixed population of molecules into discrete cell surface subdomains.
Domain (FT)
46..296; Laminin N-terminal; 297..356; Laminin EGF-like 1; 364..419; Laminin EGF-like 2; 420..469; Laminin EGF-like 3
Region
80..91; NGL discriminant loop I; 208..214; NGL discriminant loop II; 273..275; NGL discriminant loop III
Clinical Relevance4
Drugs
Interaction Protein
ENSG00000148948
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |