Protein detail
UB2D4
Ubiquitin-conjugating enzyme E2 D4 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme D4) (HBUCE1) (Ubiquitin carrier protein D4) (Ubiquitin-protein ligase D4)
Entry name UB2D4 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 5 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Ubiquitin-conjugating enzyme E2 D4 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme D4) (HBUCE1) (Ubiquitin carrier protein D4) (Ubiquitin-protein ligase D4)
Protein Class (3)
EnzymesMetabolic proteinsPredicted intracellular proteins
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
HBUCE1
Gene Description
Ubiquitin conjugating enzyme E2 D4 (putative)
Chromosome
7
Position
43926436-43956136
Supporting publications (n)
5
EVMP confidence score
0.28
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificBrain inhibitory neuronsSingle-Nuclei Brain Specificpericyte
Function & Pathway
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Cellular Component
Molecular Function (4)
Biological Process (3)
KEGG (4)
Reactome (3)
Mediation Categories
Immune mediation
Relations & Evidence18
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (8)
8 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| COMPLEX:A0AVT1_P0CG47 | UB2D4 | Q9Y2X8 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:A0AVT1_P62979 | UB2D4 | Q9Y2X8 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:A0AVT1_P0CG48 | UB2D4 | Q9Y2X8 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:A0AVT1_P62987 | UB2D4 | Q9Y2X8 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P22314_P62979 | UB2D4 | Q9Y2X8 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P22314_P62987 | UB2D4 | Q9Y2X8 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG47_P22314 | UB2D4 | Q9Y2X8 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG48_P22314 | UB2D4 | Q9Y2X8 | Yes | Yes | SIGNOR | SIGNOR:34199813 |
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Ub:E2 | UBBUBE2D4 | P0CG47Q9Y2X8 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | UBCUBE2D4 | P0CG48Q9Y2X8 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | RPS27AUBE2D4 | P62979Q9Y2X8 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | UBA52UBE2D4 | P62987Q9Y2X8 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| ALDH1A2IPO5KPNB1NUP153NUP214NUP98NUTF2RANRANBP2TNPO1UBCUBE2D4XPO1XPOT | O00410O14980O43592O94788P0CG48P35658P49790P49792P52948P61970P62826Q14974Q92973Q9Y2X8 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7166 | ||
| BTRCCUL1FBXL12FBXO33FBXO42FBXO5RBX1SKP1UBE2D4USP47 | P62877P63208Q13616Q6P3S6Q7Z6M2Q96K76Q9NXK8Q9UKT4Q9Y297Q9Y2X8 | 1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8648 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
147
Mass
16,649
Sequence
MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
Domain & Motif Annotations
Domain (FT)
1..147; UBC core
Protein Families
Ubiquitin-conjugating enzyme family
Sequence Similarities
Belongs to the ubiquitin-conjugating enzyme family.
Clinical Relevance
Antibody
Interaction Protein (25)
ENSG00000013561ENSG00000022840ENSG00000070423ENSG00000080561ENSG00000091073ENSG00000101871ENSG00000121481ENSG00000123091ENSG00000138942ENSG00000146755ENSG00000157450ENSG00000158717ENSG00000159461ENSG00000163481ENSG00000165886ENSG00000167770ENSG00000168411ENSG00000168894ENSG00000171206ENSG00000178498ENSG00000186187ENSG00000204227ENSG00000204308ENSG00000204599ENSG00000265491
Interaction Count
25
Interaction Dataset (2)
intact_biogridintact_biogrid_bioplex
Supporting Publications5
| PMID | Title | Related sentences |
|---|---|---|
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No related sentences available |
| 30071318 | Changes in the urinary extracellular vesicle proteome are associated with nephronophthisis-related ciliopathies. | No related sentences available |
| 31685984 | Tumour exosomal CEMIP protein promotes cancer cell colonization in brain metastasis. | Proteomic analysis identified cell migration-inducing and hyaluronan-binding protein (CEMIP) as elevated in exosomes from brain metastatic but not lung or bone metastatic cells. |
| 38136601 | Identification of Central Nervous System Oncologic Disease Biomarkers in EVs from Cerebrospinal Fluid (CSF) of Pediatric Patients: A Pilot Neuro-Proteomic Study. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |