Protein detail

ACOT9

Acyl-coenzyme A thioesterase 9, mitochondrial (Acyl-CoA thioesterase 9) (EC 3.1.2.-) (EC 3.1.2.2) (Acyl-CoA thioester hydrolase 9)

Entry name ACOT9	UniProt ID Q9Y305	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count	Protein classification Metabolic proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Acyl-coenzyme A thioesterase 9, mitochondrial (Acyl-CoA thioesterase 9) (EC 3.1.2.-) (EC 3.1.2.2) (Acyl-CoA thioester hydrolase 9)

Protein Class (2)

Metabolic proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000123130

Entrez Gene Symbol

ACOT9

Gene Synonym (3)

ACATE2CGI-16MT-ACT48

Gene Description

Acyl-CoA thioesterase 9

Chromosome

Position

23701055-23766475

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization6

Tissue SpecificliverCell SpecificcDCSingle-Nuclei Brain SpecificfibroblastBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (2)

Molecular Function (4)

Biological Process (3)

Reactome (3)

Canonical Pathways (3)

M184 Pid ecadherin keratinocyte pathway
M210 Pid il8 cxcr2 pathway
M16801 Sig regulation of the actin cytoskeleton by rho gtpases

Mediation Categories

Metabolism mediation

Relations & Evidence10

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (5)

5 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster88	ACOT9 SAR1A SAR1B SOD2 ZC4H2	P04179 Q9NQZ6 Q9NR31 Q9Y305 Q9Y6B6	1:1:1:1:1	Compleat	Compleat:HC2528	22036573
	ACOT9 HIBCH NUDT19 SRI	A8MXV4 P30626 Q6NVY1 Q9Y305	0:0:0:0	hu.MAP2
	ACOT9 FAH HIBCH MACROD1	P16930 Q6NVY1 Q9BQ69 Q9Y305	0:0:0:0	hu.MAP
	ACOT9 FAH HIBCH	P16930 Q6NVY1 Q9Y305	0:0:0	hu.MAP
	ACOT9 CBR4 HSD17B8 MOCOS	Q8N4T8 Q92506 Q96EN8 Q9Y305	0:0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometryWestern blottingELISA	5	36064647 38113368 40465195 37322475 33592500

Sequence, Structure & Domains8

Sequences

Length

439

Mass

49,902

Sequence

MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQRHFNSMSGPATLRKDYLVEP

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9Y305-1; Sequence=Displayed; Name=2; IsoId=Q9Y305-2; Sequence=VSP_036419; Name=3; IsoId=Q9Y305-3; Sequence=VSP_036420; Name=4; IsoId=Q9Y305-4; Sequence=VSP_041093

Alternative Sequence

1..60; Missing (in isoform 3); 5..39; ALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHE -> PC (in isoform 2); 39; E -> EACSSIHVNH (in isoform 4)

Domain & Motif Annotations

Domain (FT)

84..209; HotDog ACOT-type 1; 289..401; HotDog ACOT-type 2

Protein Families

Acyl coenzyme A hydrolase family

Sequence Similarities

Belongs to the acyl coenzyme A hydrolase family.

Clinical Relevance1

Antibody

HPA035533

Supporting Publications2

PMID	Title	Abstract
39290459	Urinary extracellular vesicles as a monitoring tool for renal damage in patients not meeting criteria for chronic kidney disease.	No abstract available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No abstract available