Protein detail
RPGF2
Rap guanine nucleotide exchange factor 2 (Cyclic nucleotide ras GEF) (CNrasGEF) (Neural RAP guanine nucleotide exchange protein) (nRap GEP) (PDZ domain-containing guanine nucleotide exchange factor 1) (PDZ-GEF1) (RA-GEF-1) (Ras/Rap1-associating GEF-1)
Protein symbol RPGF2 | UniProt ID | EVMP score 0.63 |
Frequency 10 | Transmembrane count | Protein classification |
Basic Information
Protein Names
Rap guanine nucleotide exchange factor 2 (Cyclic nucleotide ras GEF) (CNrasGEF) (Neural RAP guanine nucleotide exchange protein) (nRap GEP) (PDZ domain-containing guanine nucleotide exchange factor 1) (PDZ-GEF1) (RA-GEF-1) (Ras/Rap1-associating GEF-1)
Protein Function
- Human disease related genes:Nervous system diseases:Epilepsy
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Frequency
10
EVMP Score
0.63
Fluorescence & Localization
Tissue SpecificesophagusCell SpecificBasal keratinocytes
Function & Pathway
Protein Function
- Human disease related genes:Nervous system diseases:Epilepsy
- Disease related genes
- Predicted intracellular proteins
Cellular Component
- GO:0005737 cytoplasm
- GO:0005770 late endosome
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005923 bicellular tight junction
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0030139 endocytic vesicle
- GO:0032991 protein-containing complex
- GO:0043005 neuron projection
- GO:0043025 neuronal cell body
- GO:0045202 synapse
- GO:0048471 perinuclear region of cytoplasm
Molecular Function
- GO:0005085 guanyl-nucleotide exchange factor activity
- GO:0005096 GTPase activator activity
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0019992 diacylglycerol binding
- GO:0030165 PDZ domain binding
- GO:0030552 cAMP binding
- GO:0031697 beta-1 adrenergic receptor binding
- GO:0050699 WW domain binding
- GO:0070300 phosphatidic acid binding
Biological Process
KEGG
Mediation Categories
Fusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RAPGEF2 | PRKCQ | Q04759 | S | 960 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:18796635SIGNOR:18796635ProtMapper:22888329 |
| RAPGEF2 | CSNK1A1 | P48729 | S | 1,248 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| RAPGEF2 | CSNK1A1 | P48729 | S | 1,244 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| RAPGEF2 | IKBKB | O14920 | S | 1,254 | phosphorylation | Sparser_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:24290981 |
| RAPGEF2 | CDK5 | Q00535 | S | 1,124 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:25189171ProtMapper:25628530 |
| RAPGEF2 | ANXA1 | P04083 | S | 1,124 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:25189171 |
Ligand-Receptor Signaling
8 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | No | No | No |
| tight_junction | tight_junction | OmniPath | Yes | Yes | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| RPGF2 | Q9Y4G8 | RAP1A | P62834 | Yes | Yes | No | HPRDHINTSIGNORCA1 | CA1:10608883SIGNOR:24290981HPRD:10934204HINT:10934204HINT:10608883HINT:10608844HPRD:10608844HPRD:10608883 |
| KC1A | P48729 | RPGF2 | Q9Y4G8 | Yes | No | Yes | iPTMnetPhosphoSite_norefSIGNORProtMapperPhosphoSite_ProtMapper | SIGNOR:24290981 |
| IKKB | O14920 | RPGF2 | Q9Y4G8 | Yes | No | Yes | Sparser_ProtMapperPhosphoSite_norefSIGNORiPTMnetProtMapperREACH_ProtMapperPhosphoSite_ProtMapper | SIGNOR:24290981ProtMapper:24290981 |
| KPCT | Q04759 | RPGF2 | Q9Y4G8 | Yes | Yes | No | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:18796635ProtMapper:18796635SIGNOR:18796635ProtMapper:22888329 |
| NEDD4 | P46934 | RPGF2 | Q9Y4G8 | Yes | No | Yes | HINTSIGNORBioGRID | HINT:11598133BioGRID:24340059HINT:21765395SIGNOR:24340059 |
| CDK5 | Q00535 | RPGF2 | Q9Y4G8 | Yes | Yes | No | Sparser_ProtMapperSIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapper | ProtMapper:25189171ProtMapper:34814918ProtMapper:25628530SIGNOR:25189171 |
| COMPLEX:P63208_Q13616_Q9Y297 | RPGF2 | Q9Y4G8 | Yes | No | Yes | SIGNOR | SIGNOR:24290981 |
Protein Complex Composition
Isolation & Detection Technology
Sequence, Structure & Domains
Sequences
Length
1,499
Mass
167,417
Sequence
MKPLAIPANHGVMGQQEKHSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGSKATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQDDSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFSATPDLPDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTATPDQYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPTEYIDDLFKLRSKTSCANLKRFEEVINQETFWVASEILRETNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDLQDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRMASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQYLSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPVKSETSPVAPRAGSQQKAQSLPQPQQQPPPAHKINQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTSPQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVETNLGMGRMERRTMIEPDQYSLGSYAPMSEGRGLYATATVISSPSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNIQTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPPPTPPGYIGIPITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y4G8-1; Sequence=Displayed; Name=2; IsoId=Q9Y4G8-2; Sequence=VSP_062494
Alternative Sequence
1..20; MKPLAIPANHGVMGQQEKHS -> MASYVDNSFRQAVMKNPPERTPQDLEIVYSYLHGMEALSNLREHQLRLMCETVRYERHEANEVLYYPDDIGTCWYILLSGSVFIKESMFLPRSSFGKRSAGSFRRGCECIVLEPSEMIVVDYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPMGKPPLPRGYHTECTKSQ (in isoform 2)
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
83..94; Acidic residues; 1031..1040; Low complexity; 1111..1125; Low complexity; 1141..1160; Low complexity; 1247..1256; Polar residues; 1307..1331; Polar residues; 1355..1366; Low complexity; 1441..1462; Polar residues; 1488..1499; Acidic residues
Domain (CC)
The Ras-associating domain is necessary for the Rap guanine nucleotide exchange activity. The N-terminal regionis necessary for cAMP-binding. The PDZ domain is necessary for its targeting to the cell membrane.
Domain (FT)
267..380; N-terminal Ras-GEF; 385..470; PDZ; 606..692; Ras-associating; 717..944; Ras-GEF
Region
40..59; Disordered; 68..101; Disordered; 1002..1050; Disordered; 1095..1160; Disordered; 1224..1256; Disordered; 1305..1499; Disordered
Protein Families
RAPGEF2 family
Sequence Similarities
Belongs to the RAPGEF2 family.
Clinical Relevance
Interaction Protein
ENSG00000108953ENSG00000128245ENSG00000170027
Interaction Count
3
Interaction Dataset
biogrid_opencell