Protein detail

ZN706

Zinc finger protein 706

Entry name ZN706	UniProt ID Q9Y5V0	EVMP confidence score 0.38
Supporting publications (n) 2	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

Zinc finger protein 706

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000120963

Entrez Gene Symbol

ZNF706

Supporting publications (n)

EVMP confidence score

0.38

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (2)

Molecular Function

GO:0046872 metal ion binding

Biological Process (3)

Reactome

R-hsa-73857 rna polymerase ii transcription

Mediation Categories

Other mediation

Relations & Evidence7

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ATP6V1A CSE1L DNPH1 TXNDC5 UBR1 UCHL3 USP5 ZNF593 ZNF706	O00488 O43598 P15374 P38606 P45974 P55060 Q8IWV7 Q8NBS9 Q9Y5V0	0:0:0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_570
	CIT USO1 USP28 ZNF706	O14578 O60763 Q96RU2 Q9Y5V0	0:0:0:0	Havugimana2012	Havugimana2012:C_155

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometryR Sequencing	18	40189497 26826536 40985879 38207106 40831280 36064647 38113368 40465195 37322475 36497184 34064677 33592500 32854315 41307968 36146834 40840701 38207106 39207047

Sequence, Structure & Domains6

Sequences

Length

Mass

8,498

Sequence

MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA

Domain & Motif Annotations

Compositional Bias

1..13; Low complexity; 14..25; Basic residues; 53..62; Basic and acidic residues

Zinc Finger

39..62; C2H2-type

Region

1..32; Disordered; 53..76; Disordered

Supporting Publications2

PMID	Title	Abstract
26775013	Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available