Protein detail
ZN706
Zinc finger protein 706
Entry name ZN706 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 2 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Zinc finger protein 706
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.28
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence7
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (2)
2 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ATP6V1ACSE1LDNPH1TXNDC5UBR1UCHL3USP5ZNF593ZNF706 | O00488O43598P15374P38606P45974P55060Q8IWV7Q8NBS9Q9Y5V0 | 0:0:0:0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_570 | ||
| CITUSO1USP28ZNF706 | O14578O60763Q96RU2Q9Y5V0 | 0:0:0:0 | Havugimana2012 | Havugimana2012:C_155 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometryR Sequencing | 18 | 401894972682653640985879382071064083128036064647381133684046519537322475364971843406467733592500328543154130796836146834408407013820710639207047 |
Sequence, Structure & Domains
Sequences
Length
76
Mass
8,498
Sequence
MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA
Domain & Motif Annotations
Compositional Bias
1..13; Low complexity; 14..25; Basic residues; 53..62; Basic and acidic residues
Zinc Finger
39..62; C2H2-type
Region
1..32; Disordered; 53..76; Disordered
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 26775013 | Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |