Protein detail
SNX9
Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A)
Entry name SNX9 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sorting nexin-9 (SH3 and PX domain-containing protein 1) (Protein SDP1) (SH3 and PX domain-containing protein 3A)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
SDP1SH3PX1SH3PXD3A
Gene Description
Sorting nexin 9
Chromosome
6
Position
157700387-157945077
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Cell SpecificAdipocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (12)
- GO:0001726 ruffle
- GO:0005737 cytoplasm
- GO:0005802 trans-Golgi network
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005905 clathrin-coated pit
- GO:0030136 clathrin-coated vesicle
- GO:0030659 cytoplasmic vesicle membrane
- GO:0031410 cytoplasmic vesicle
- GO:0032437 cuticular plate
Page 1 of 2
Molecular Function (8)
Biological Process (3)
Reactome (5)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence17
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SNX9 | Q9Y5X1 | EGFR | P00533 | Yes | Yes | HINTLit-BM-17SignaLink3 | HINT:24658140SignaLink3:16316319HINT:25402006Lit-BM-17:25402006SignaLink3:23331499Lit-BM-17:24658140 | |
| SNX9 | Q9Y5X1 | DYN2 | P50570 | Yes | Yes | DOMINOSIGNORHPRDHINTBioGRIDIntActSPIKE_LC | IntAct:15703209DOMINO:15703209BioGRID:18388313HINT:35271311HPRD:15299020IntAct:18388313HPRD:15703209SPIKE_LC:15703209HINT:18388313IntAct:27107012SIGNOR:15703209HINT:15703209HINT:33961781 | |
| ACK1 | Q07912 | SNX9 | Q9Y5X1 | Yes | Yes | DOMINOiPTMnetPhosphoPointSIGNORHPRDBioGRIDSPIKE_LCLit-BM-17 | SPIKE_LC:11799118BioGRID:16316319HPRD:11799118DOMINO:16137687Lit-BM-17:16137687SIGNOR:16316319HPRD:16137687Lit-BM-17:16316319 | |
| SNX9 | Q9Y5X1 | DYN1 | Q05193 | Yes | Yes | DOMINOSIGNORHPRDHINTIntActSPIKE_LC | IntAct:18353773IntAct:15703209DOMINO:15703209HINT:35271311HINT:18353773HINT:16137687HPRD:15703209SPIKE_LC:15703209DOMINO:16137687IntAct:16137687SIGNOR:15703209HINT:15703209HINT:33961781 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| SNX9SYNJ1 | O43426Q9Y5X1 | 0:0 | hu.MAP2 | |||
| DNM1DNM2DNM3RABIFSNX9 | P47224P50570Q05193Q9UQ16Q9Y5X1 | 0:0:0:0:0 | hu.MAP2 | |||
| DPPA4RNASE7SNX9 | Q7L190Q9H1E1Q9Y5X1 | 0:0:0 | hu.MAP2 | |||
| DPPA4SNX9 | Q7L190Q9Y5X1 | 0:0 | hu.MAP | |||
| SNX9 | Q9Y5X1 | 2 | PDB | PDB:2raiPDB:3dyu |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30550287 |
Sequence, Structure & Domains
Sequences
Length
595
Mass
66,592
Sequence
MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
3D Structural Models
Turn
15..18; 167..169; 277..279; 302..304
Helix
54..56; 175..180; 215..221; 257..259; 287..301; 324..339; 344..346; 348..355; 359..370; 376..382; 392..428; 430..450; 455..457; 458..480; 482..484; 486..500; 503..518; 520..525; 531..590
Beta Strand
3..9; 27..33; 39..43; 49..53; 57..59; 232..237; 240..243; 252..255; 260..262; 263..266; 271..276; 283..286; 383..387
3D Structure
NMR spectroscopy (1); X-ray crystallography (6)
Domain & Motif Annotations
Compositional Bias
111..121; Polar residues; 135..145; Polar residues; 160..169; Acidic residues; 191..201; Polar residues
Domain (CC)
The PX domain mediates interaction with membranes enriched in phosphatidylinositol phosphate. Has high affinity for phosphatidylinositol 4,5-bisphosphate, but can also bind to membranes enriched in other phosphatidylinositol phosphates.
Domain (FT)
1..62; SH3; 250..361; PX; 392..595; BAR
Region
91..201; Disordered; 201..213; Critical for tubulation activity
Protein Families
Sorting nexin family
Sequence Similarities
Belongs to the sorting nexin family.
Clinical Relevance
Drugs (2)
Interaction Protein (10)
ENSG00000015285ENSG00000061938ENSG00000078747ENSG00000079805ENSG00000106976ENSG00000117560ENSG00000143537ENSG00000146648ENSG00000168615ENSG00000197959
Interaction Count
10
Interaction Dataset (3)
intact_biogridintact_biogrid_opencellbiogrid_opencell
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |