Protein detail

KPTN

KICSTOR complex protein kaptin (Actin-associated protein 2E4)

Entry name KPTN	UniProt ID Q9Y664	EVMP confidence score 0.50
Supporting publications (n) 5	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

KICSTOR complex protein kaptin (Actin-associated protein 2E4)

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Disease related genes
Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins

Ensembl

ENSG00000118162

Entrez Gene Symbol

KPTN

Gene Synonym (2)

2E4KICS4

Gene Description

Kaptin, actin binding protein

Chromosome

Position

47475150-47484265

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Function & Pathway6

Protein Function (3)

Disease related genes
Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins

Cellular Component (6)

Molecular Function

GO:0051015 actin filament binding

Biological Process (3)

Reactome (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence9

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (4)

4 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
KICSTOR complex	ITFG2 KICS2 KPTN SZT2	Q5T011 Q969R8 Q96MD2 Q9Y664	1:1:1:1	CORUMhu.MAPComplexPortal	intact:EBI-26361505CORUM:6754	28199306 14755292
	ITFG2 KICS2 KPTN SZT2 TMCO4	Q5T011 Q5TGY1 Q969R8 Q96MD2 Q9Y664	0:0:0:0:0	hu.MAPhu.MAP2
	ITFG2 KICS2 KPTN TMCO4	Q5TGY1 Q969R8 Q96MD2 Q9Y664	0:0:0:0	hu.MAP
	ITFG2 KPTN	Q969R8 Q9Y664	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry	0

Sequence, Structure & Domains5

Sequences

Length

436

Mass

48,080

Sequence

MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y664-1; Sequence=Displayed; Name=2; IsoId=Q9Y664-2; Sequence=VSP_053990

Alternative Sequence

1..240; Missing (in isoform 2)

Clinical Relevance5

Disease Involvement (2)

Disease variantIntellectual disability

Antibody (2)

HPA041710 HPA041796

Interaction Protein (4)

ENSG00000103148ENSG00000111203ENSG00000174206ENSG00000198198

Interaction Count

Interaction Dataset

biogrid_bioplex

Supporting Publications5

PMID	Title	Abstract
24700864	Human urinary exosomes as innate immune effectors.	No abstract available
26801919	Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis.	No abstract available
33709510	Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available
41201090	Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma.	No abstract available