Protein detail

CLIC4

Chloride intracellular channel protein 4 (Glutaredoxin-like oxidoreductase CLIC4) (EC 1.8.-.-) (Intracellular chloride ion channel protein p64H1)

Entry name CLIC4	UniProt ID Q9Y696	EVMP confidence score 0.88
Supporting publications (n) 41	Transmembrane count 1	Protein classification Predicted intracellular proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Chloride intracellular channel protein 4 (Glutaredoxin-like oxidoreductase CLIC4) (EC 1.8.-.-) (Intracellular chloride ion channel protein p64H1)

Protein Class (2)

Predicted intracellular proteinsTransporters

Protein Function (2)

Transporters:Transporter channels and pores
Predicted intracellular proteins

Transmembrane

37..57; Helical; Note=After insertion into the membrane

Transmembrane Count

Ensembl

ENSG00000169504

Entrez Gene Symbol

CLIC4

Gene Synonym (5)

CLIC4LDKFZP566G223H1huH1P64H1

Gene Description

Chloride intracellular channel 4

Chromosome

Position

24745382-24844321

Supporting publications (n)

EVMP confidence score

0.88

Fluorescence & Localization4

Cell SpecificAdrenal medulla cellsBlood Cell SpecificeosinophilBlood Lineage Specificgranulocytes

Function & Pathway6

Protein Function (2)

Transporters:Transporter channels and pores
Predicted intracellular proteins

Cellular Component (19)

Page 1 of 2

Molecular Function (3)

Biological Process (3)

Canonical Pathways (3)

M5883 Naba secreted factors
M5885 Naba matrisome associated
M5889 Naba matrisome

Mediation Categories (2)

Clinical-translation mediationFusion and delivery mediation

Relations & Evidence21

Ligand-Receptor Signaling (11)

11 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Page 2 of 2Previous

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CDK5	Q00535	CLIC4	Q9Y696	Yes	Yes	No	SIGNORSparser_ProtMapperProtMapper	SIGNOR:30237421 ProtMapper:30237421

Protein Complex Composition (8)

8 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CLIC4 ENSA	O43768 Q9Y696	0:0	hu.MAP2
CLIC4 CLIC6 CSK RABIF	P41240 P47224 Q96NY7 Q9Y696	0:0:0:0	hu.MAP
CLIC4 CLIC6 CSK KYNU	P41240 Q16719 Q96NY7 Q9Y696	0:0:0:0	hu.MAP
CLIC4 CLIC6 CSK	P41240 Q96NY7 Q9Y696	0:0:0	hu.MAP
CLIC4 CLIC6 KYNU RABIF	P47224 Q16719 Q96NY7 Q9Y696	0:0:0:0	hu.MAP
CLIC4 CLIC6 KYNU	Q16719 Q96NY7 Q9Y696	0:0:0	hu.MAP2
CLIC4 CLIC6	Q96NY7 Q9Y696	0:0	hu.MAP2
CLIC4	Q9Y696	3	PDB	PDB:2d2z

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	6	38113368 37322475 41068253 33592500 41307968 38607062

Sequence, Structure & Domains13

Sequences

Length

253

Mass

28,772

Sequence

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

3D Structural Models

Turn

101..103; 116..120; 244..247

Helix

36..48; 64..69; 88..98; 112..115; 121..130; 134..136; 137..156; 186..206; 215..225; 228..231; 237..243

Beta Strand

19..25; 29..32; 53..57; 77..80; 83..85; 181..183

3D Structure

X-ray crystallography (3)

Domain & Motif Annotations

Motif

35..38; G-site

Domain (CC)

The active G-site contains a monothiol Cys-X-X-Ser motif which mediates glutathione-dependent redox catalysis.; DOMAIN: Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as a chloride channel. The redox status of the active cysteine in Cys-X-X-Cys/Ser motif likely determines the capacity to adopt a soluble or membrane-inserted state. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.

Domain (FT)

81..244; GST C-terminal

Region

2..101; Required for insertion into the membrane

Protein Families

Chloride channel CLIC family

Sequence Similarities

Belongs to the chloride channel CLIC family.

Clinical Relevance5

Drug Targets

Literature-reported target

Antibody (2)

HPA008019 HPA060804

Interaction Protein

ENSG00000159212

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications41

PMID	Title	Abstract
22106071	Proteomic analysis of urine exosomes by multidimensional protein identification technology (MudPIT).	No abstract available
23161513	Proteomic analysis of exosomes from mutant KRAS colon cancer cells identifies intercellular transfer of mutant KRAS.	Exosomes from mutant KRAS cells contain many tumor-promoting proteins, including KRAS, EGFR, SRC family kinases, and integrins.
24505114	Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform.	These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4.
26801919	Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis.	No abstract available
26884841	Exosomes mediated pentose phosphate pathway in ovarian cancer metastasis: a proteomics analysis.	No abstract available
27312428	A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer.	No abstract available
27723984	Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection.	No abstract available
28054239	The Protein Content of Extracellular Vesicles Derived from Expanded Human Umbilical Cord Blood-Derived CD133+ and Human Bone Marrow-Derived Mesenchymal Stem Cells Partially Explains Why both Sources are Advantageous for Regenerative Medicine.	No abstract available
30550287	Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes.	No abstract available
30608700	Quantitative Proteomic Analysis of Small and Large Extracellular Vesicles (EVs) Reveals Enrichment of Adhesion Proteins in Small EVs.	No abstract available

Page 1 of 5Next