Protein detail
CLIC4
Chloride intracellular channel protein 4 (Glutaredoxin-like oxidoreductase CLIC4) (EC 1.8.-.-) (Intracellular chloride ion channel protein p64H1)
Entry name CLIC4 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 41 | Transmembrane count 1 | Protein classification Predicted intracellular proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Chloride intracellular channel protein 4 (Glutaredoxin-like oxidoreductase CLIC4) (EC 1.8.-.-) (Intracellular chloride ion channel protein p64H1)
Protein Class (2)
Predicted intracellular proteinsTransporters
Protein Function (2)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
Transmembrane
37..57; Helical; Note=After insertion into the membrane
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CLIC4LDKFZP566G223H1huH1P64H1
Gene Description
Chloride intracellular channel 4
Chromosome
1
Position
24745382-24844321
Supporting publications (n)
41
EVMP confidence score
0.88
Fluorescence & Localization
Cell SpecificAdrenal medulla cellsBlood Cell SpecificeosinophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (2)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
Cellular Component (19)
- GO:0005737 cytoplasm
- GO:0005739 mitochondrion
- GO:0005789 endoplasmic reticulum membrane
- GO:0005813 centrosome
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005902 microvillus
- GO:0005911 cell-cell junction
- GO:0009986 cell surface
- GO:0015629 actin cytoskeleton
Page 1 of 2
Molecular Function (3)
Biological Process (3)
Canonical Pathways (3)
- M5883 Naba secreted factors
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence21
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location |
Page 1 of 2Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CDK5 | Q00535 | CLIC4 | Q9Y696 | Yes | Yes | SIGNORSparser_ProtMapperProtMapper | SIGNOR:30237421ProtMapper:30237421 |
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CLIC4ENSA | O43768Q9Y696 | 0:0 | hu.MAP2 | |||
| CLIC4CLIC6CSKRABIF | P41240P47224Q96NY7Q9Y696 | 0:0:0:0 | hu.MAP | |||
| CLIC4CLIC6CSKKYNU | P41240Q16719Q96NY7Q9Y696 | 0:0:0:0 | hu.MAP | |||
| CLIC4CLIC6CSK | P41240Q96NY7Q9Y696 | 0:0:0 | hu.MAP | |||
| CLIC4CLIC6KYNURABIF | P47224Q16719Q96NY7Q9Y696 | 0:0:0:0 | hu.MAP | |||
| CLIC4CLIC6KYNU | Q16719Q96NY7Q9Y696 | 0:0:0 | hu.MAP2 | |||
| CLIC4CLIC6 | Q96NY7Q9Y696 | 0:0 | hu.MAP2 | |||
| CLIC4 | Q9Y696 | 3 | PDB | PDB:2d2z |
Isolation & Detection Technology (1)
Sequence, Structure & Domains
Sequences
Length
253
Mass
28,772
Sequence
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
3D Structural Models
Turn
101..103; 116..120; 244..247
Helix
36..48; 64..69; 88..98; 112..115; 121..130; 134..136; 137..156; 186..206; 215..225; 228..231; 237..243
Beta Strand
19..25; 29..32; 53..57; 77..80; 83..85; 181..183
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Motif
35..38; G-site
Domain (CC)
The active G-site contains a monothiol Cys-X-X-Ser motif which mediates glutathione-dependent redox catalysis.; DOMAIN: Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as a chloride channel. The redox status of the active cysteine in Cys-X-X-Cys/Ser motif likely determines the capacity to adopt a soluble or membrane-inserted state. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.
Domain (FT)
81..244; GST C-terminal
Region
2..101; Required for insertion into the membrane
Protein Families
Chloride channel CLIC family
Sequence Similarities
Belongs to the chloride channel CLIC family.