Protein detail

5MP1

eIF5-mimic protein 1 (Basic leucine zipper and W2 domain-containing protein 2)

Entry name 5MP1	UniProt ID Q9Y6E2	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

eIF5-mimic protein 1 (Basic leucine zipper and W2 domain-containing protein 2)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000136261

Entrez Gene Symbol

BZW2

Gene Synonym (4)

5MP1HSPC028MST017MSTP017

Gene Description

Basic leucine zipper and W2 domains 2

Chromosome

Position

16646131-16706523

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization5

Tissue Specificbone marrowCell SpecificEarly primary spermatocytesSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnaive B-cellBlood Lineage SpecificB-cells

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (2)

Molecular Function (2)

Biological Process (3)

Canonical Pathways (3)

M3005 Naba collagens
M198 Pid syndecan 1 pathway
M239 Pid a6b1 a6b4 integrin pathway

Mediation Categories

Other mediation

Relations & Evidence13

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
5MP1	Q9Y6E2	EIF3A	Q14152	Yes	Yes	No	SIGNOR	SIGNOR:31643092
5MP1	Q9Y6E2	IF2A	P05198	Yes	Yes	No	SIGNOR	SIGNOR:31643092

Protein Complex Composition (5)

5 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
BZW2 CARM1 EP300 NFKB1 NFKBIA REL RELA TWIST1	P19838 P25963 Q04206 Q04864 Q09472 Q15672 Q86X55 Q9Y6E2	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9458
BZW1 BZW2 TMEM167B	Q7L1Q6 Q9NRX6 Q9Y6E2	0:0:0	hu.MAP2
BZW1 BZW2	Q7L1Q6 Q9Y6E2	0:0	hu.MAP
BZW2 MUL1 TMEM167B	Q969V5 Q9NRX6 Q9Y6E2	0:0:0	hu.MAP2
BZW2 TMEM167B	Q9NRX6 Q9Y6E2	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometryR Sequencing	2	27605433 28396511

Sequence, Structure & Domains9

Sequences

Length

419

Mass

48,162

Sequence

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y6E2-1; Sequence=Displayed; Name=2; IsoId=Q9Y6E2-2; Sequence=VSP_055568, VSP_055569

Alternative Sequence

182..201; IAASFAVKLFKAWMAEKDAN -> NEAPVFSPVRQQKKNKVTDS (in isoform 2); 202..419; Missing (in isoform 2)

Domain & Motif Annotations

Domain (FT)

248..415; W2

Region

1..22; Disordered

Protein Families

BZW family

Sequence Similarities

Belongs to the BZW family.

Clinical Relevance4

Antibody (2)

HPA022813 HPA026709

Interaction Protein

ENSG00000082153

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
27601599	Comprehensive Proteomic Analysis of Human Milk-derived Extracellular Vesicles Unveils a Novel Functional Proteome Distinct from Other Milk Components.	No abstract available