Protein detail

ATP23

Mitochondrial inner membrane protease ATP23 homolog (EC 3.4.24.-) (Ku70-binding protein 3) (XRCC6-binding protein 1)

Entry name ATP23	UniProt ID Q9Y6H3	EVMP confidence score 0.38
Supporting publications (n) 4	Transmembrane count	Protein classification EnzymesEssential proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Mitochondrial inner membrane protease ATP23 homolog (EC 3.4.24.-) (Ku70-binding protein 3) (XRCC6-binding protein 1)

Protein Class (3)

EnzymesEssential proteinsPredicted intracellular proteins

Protein Function (3)

Peptidases:Metallopeptidases
Enzymes
Predicted intracellular proteins

Ensembl

ENSG00000166896

Entrez Gene Symbol

ATP23

Gene Synonym (2)

KUB3XRCC6BP1

Gene Description

ATP23 metallopeptidase and ATP synthase assembly factor homolog

Chromosome

Position

57906039-57959148

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization6

Tissue SpecificlungCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificmyeloid DCBlood Lineage SpecificB-cells

Function & Pathway5

Protein Function (3)

Peptidases:Metallopeptidases
Enzymes
Predicted intracellular proteins

Cellular Component (6)

Molecular Function (4)

Biological Process (3)

Mediation Categories

Metabolism mediation

Relations & Evidence8

Ligand-Receptor Signaling (3)

3 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (4)

4 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
DNA-dependent protein kinase-DNA ligase 4 complex	ATP23 LIG4 PRKDC XRCC4 XRCC5 XRCC6	P12956 P13010 P49917 P78527 Q13426 Q9Y6H3	1:1:1:1:1:1	Compleat	Compleat:HC1767	15194694 10219089
	ATP23 BACH1 MAFB MAFG MAFK NFE2L3	O14867 O15525 O60675 Q9Y4A8 Q9Y5Q3 Q9Y6H3	0:0:0:0:0:0	hu.MAP2
	ATP23 BACH1 FAM83D HMMR MAFB MAFK	O14867 O60675 O75330 Q9H4H8 Q9Y5Q3 Q9Y6H3	0:0:0:0:0:0	hu.MAP2
	ATP23 CSPP1 GAN KBTBD8 KLHL29 MOG WDR76	Q16653 Q1MSJ5 Q8NFY9 Q96CT2 Q9H2C0 Q9H967 Q9Y6H3	0:0:0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry	0

Sequence, Structure & Domains5

Sequences

Length

246

Mass

28,081

Sequence

MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI

Domain & Motif Annotations

Protein Families

Peptidase M76 family

Sequence Similarities

Belongs to the peptidase M76 family.

Clinical Relevance1

Antibody (2)

HPA035804 HPA043204

Supporting Publications4

PMID	Title	Abstract
31805958	Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment.	No abstract available
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
37563857	Comprehensive characterization of human brain-derived extracellular vesicles using multiple isolation methods: Implications for diagnostic and therapeutic applications.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available