Protein detail
S4A7
Sodium bicarbonate cotransporter 3 (Electroneutral Na/HCO(3) cotransporter) (Sodium bicarbonate cotransporter 2) (Sodium bicarbonate cotransporter 2b) (Bicarbonate transporter) (Solute carrier family 4 member 7)
Entry name S4A7 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 8 | Transmembrane count 11 | Protein classification Essential proteinsMetabolic proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sodium bicarbonate cotransporter 3 (Electroneutral Na/HCO(3) cotransporter) (Sodium bicarbonate cotransporter 2) (Sodium bicarbonate cotransporter 2b) (Bicarbonate transporter) (Solute carrier family 4 member 7)
Protein Class (4)
Essential proteinsMetabolic proteinsPredicted membrane proteinsTransporters
Protein Function
Transporters:Electrochemical Potential-driven transporters
Transmembrane
609..629; Helical; 638..658; Helical; 696..716; Helical; 726..746; Helical; 818..838; Helical; 862..882; Helical; 909..929; Helical; 955..975; Helical; 1012..1032; Helical; 1035..1055; Helical; 1093..1113; Helical
Transmembrane Count
11
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
NBC3SBC2SLC4A6
Gene Description
Solute carrier family 4 member 7
Chromosome
3
Position
27372721-27484420
Supporting publications (n)
8
EVMP confidence score
0.50
Fluorescence & Localization
Cell SpecificLate spermatidsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
Transporters:Electrochemical Potential-driven transporters
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
Reactome (11)
- R-hsa-425381 bicarbonate transporters
- R-hsa-9013405 rhod gtpase cycle
- R-hsa-9035034 rhof gtpase cycle
- R-hsa-9013407 rhoh gtpase cycle
- R-hsa-9013409 rhoj gtpase cycle
- R-hsa-9013406 rhoq gtpase cycle
- R-hsa-9012999 rho gtpase cycle
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-9958790 slc mediated transport of inorganic anions
Page 1 of 2
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence32
Ligand-Receptor Signaling (31)
31 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane_predicted | Phobius | Yes |
Page 4 of 4Previous
Sequence, Structure & Domains
Sequences
Length
1,214
Mass
136,044
Sequence
MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHRHRGHKHHHRRRKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADIGKKHSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLGHLLPSSRAGTPAGSRCTTPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHPPEEDLEAALKGEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMRKIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQYHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKSVPSQEKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPSNETLAQWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSSFLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGWIISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGVMLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLWKVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPESKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFEDEPRKKYVDAETSL
Alternative Products
Event=Alternative splicing; Named isoforms=14; Name=1; Synonyms=mNBC3, NBCn1-A; IsoId=Q9Y6M7-1; Sequence=Displayed; Name=2; Synonyms=NBCn1-F; IsoId=Q9Y6M7-2; Sequence=VSP_047844; Name=3; IsoId=Q9Y6M7-3; Sequence=VSP_047839, VSP_047842, VSP_047844, VSP_047849; Name=4; IsoId=Q9Y6M7-4; Sequence=VSP_047839, VSP_047842, VSP_047844; Name=5; IsoId=Q9Y6M7-5; Sequence=VSP_047838, VSP_047845, VSP_047848; Name=6; Synonyms=NBCn1-G; IsoId=Q9Y6M7-6; Sequence=VSP_047840, VSP_047844, VSP_047848; Name=7; Synonyms=NBCn1-D; IsoId=Q9Y6M7-7; Sequence=VSP_047841, VSP_047848; Name=8; Synonyms=NBCn1-C; IsoId=Q9Y6M7-8; Sequence=VSP_047841, VSP_047843, VSP_047848; Name=9; Synonyms=NBCn1-E; IsoId=Q9Y6M7-9; Sequence=VSP_047840, VSP_047844; Name=10; IsoId=Q9Y6M7-10; Sequence=VSP_047840, VSP_047843, VSP_047846, VSP_047847; Name=11; IsoId=Q9Y6M7-11; Sequence=VSP_047840, VSP_047844, VSP_047846, VSP_047847; Name=12; Synonyms=NBCn1-H; IsoId=Q9Y6M7-12; Sequence=VSP_047840, VSP_047843; Name=13; IsoId=Q9Y6M7-13; Sequence=VSP_047841, VSP_047844, VSP_047848; Name=14; IsoId=Q9Y6M7-14; Sequence=VSP_047841, VSP_047844, VSP_047846, VSP_047847
Alternative Sequence
1..450; Missing (in isoform 5); 1..90; Missing (in isoform 3 and isoform 4); 1..11; MERFRLEKKLP -> MEADGAGEQMRPLLTR (in isoform 6, isoform 9, isoform 10, isoform 11 and isoform 12); 1..11; MERFRLEKKLP -> MEADGAGEQMRPLLTRVTSR (in isoform 7, isoform 8, isoform 13 and isoform 14); 91..118; SQRVQFILGTEDDDEEHIPHDLFTEMDE -> MAVTQFIHFREEIMGNMFFIIIFSTKDK (in isoform 3 and isoform 4); 238..250; Missing (in isoform 8, isoform 10 and isoform 12); 251..374; Missing (in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13 and isoform 14); 451..465; PAVLLTGLTEVPVPT -> MEVVEAEKIVLLTSA (in isoform 5); 581..582; LF -> VQ (in isoform 10, isoform 11 and isoform 14); 583..1214; Missing (in isoform 10, isoform 11 and isoform 14); 1188; S -> SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS (in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 13); 1189..1214; PDKPVSVKISFEDEPRKKYVDAETSL -> GDPSIGNISDEMAKTAQWKALSMNTENAKVTRSNMSPDKPVSVK (in isoform 3)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Compositional Bias
1..12; Basic and acidic residues; 55..72; Basic residues; 73..85; Basic and acidic residues; 303..313; Pro residues; 314..332; Low complexity; 379..392; Polar residues; 563..572; Basic and acidic residues; 1144..1162; Basic and acidic residues
Motif
1211..1214; PDZ-binding
Domain (CC)
The PDZ-binding motif mediates interaction with the CFTR, NHERF1/EBP50 complex and probably with USH1C.
Region
1..22; Disordered; 52..93; Disordered; 289..346; Disordered; 362..408; Disordered; 552..572; Disordered; 1127..1214; Essential for cell membrane localization and transport activity; 1134..1136; CA2-binding; 1144..1169; Disordered; Q9Y6M7-6:1008..1131; Essential for cell membrane localization and transport activity
Protein Families
Anion exchanger (TC 2.A.31) family
Sequence Similarities
Belongs to the anion exchanger (TC 2.A.31) family.
Clinical Relevance
Supporting Publications8
| PMID | Title | Related sentences |
|---|---|---|
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No related sentences available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 37702715 | One-Pot Analytical Pipeline for Efficient and Sensitive Proteomic Analysis of Extracellular Vesicles. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 39835386 | Comparison of nanoLC-MALDI-MS/MS with nanoLC-TIMS-MS/MS in the proteomic analysis of extracellular vesicles of bronchoalveolar lavage fluid. | No related sentences available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No related sentences available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |
| 40750896 | The exosomal protein biomarkers auxiliary in diagnosis of interstitial lung disease. | No related sentences available |