Protein detail

S4A7

Sodium bicarbonate cotransporter 3 (Electroneutral Na/HCO(3) cotransporter) (Sodium bicarbonate cotransporter 2) (Sodium bicarbonate cotransporter 2b) (Bicarbonate transporter) (Solute carrier family 4 member 7)

Entry name
S4A7
UniProt ID
EVMP confidence score
0.50
Supporting publications (n)
8
Transmembrane count
11
Protein classification
Essential proteinsMetabolic proteinsPredicted membrane proteinsTransporters
Basic Information
Protein Names
Sodium bicarbonate cotransporter 3 (Electroneutral Na/HCO(3) cotransporter) (Sodium bicarbonate cotransporter 2) (Sodium bicarbonate cotransporter 2b) (Bicarbonate transporter) (Solute carrier family 4 member 7)
Protein Class (4)
Essential proteinsMetabolic proteinsPredicted membrane proteinsTransporters
Protein Function
Transporters:Electrochemical Potential-driven transporters
Transmembrane
609..629; Helical; 638..658; Helical; 696..716; Helical; 726..746; Helical; 818..838; Helical; 862..882; Helical; 909..929; Helical; 955..975; Helical; 1012..1032; Helical; 1035..1055; Helical; 1093..1113; Helical
Transmembrane Count
11
Entrez Gene Symbol
Gene Synonym (3)
NBC3SBC2SLC4A6
Gene Description
Solute carrier family 4 member 7
Chromosome
3
Position
27372721-27484420
Supporting publications (n)
8
EVMP confidence score
0.50
Fluorescence & Localization
Cell SpecificLate spermatidsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Relations & Evidence32

Ligand-Receptor Signaling (31)

31 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembranetransmembrane_predictedPhobiusYes
Page 4 of 4Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationMass spectrometryR Sequencing23114125131137684
Sequence, Structure & Domains

Sequences

Length
1,214
Mass
136,044
Sequence
MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHRHRGHKHHHRRRKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADIGKKHSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLGHLLPSSRAGTPAGSRCTTPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHPPEEDLEAALKGEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMRKIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQYHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKSVPSQEKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDFKDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPSNETLAQWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSSFLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGWIISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGVMLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLWKVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPESKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFEDEPRKKYVDAETSL
Alternative Products
Event=Alternative splicing; Named isoforms=14; Name=1; Synonyms=mNBC3, NBCn1-A; IsoId=Q9Y6M7-1; Sequence=Displayed; Name=2; Synonyms=NBCn1-F; IsoId=Q9Y6M7-2; Sequence=VSP_047844; Name=3; IsoId=Q9Y6M7-3; Sequence=VSP_047839, VSP_047842, VSP_047844, VSP_047849; Name=4; IsoId=Q9Y6M7-4; Sequence=VSP_047839, VSP_047842, VSP_047844; Name=5; IsoId=Q9Y6M7-5; Sequence=VSP_047838, VSP_047845, VSP_047848; Name=6; Synonyms=NBCn1-G; IsoId=Q9Y6M7-6; Sequence=VSP_047840, VSP_047844, VSP_047848; Name=7; Synonyms=NBCn1-D; IsoId=Q9Y6M7-7; Sequence=VSP_047841, VSP_047848; Name=8; Synonyms=NBCn1-C; IsoId=Q9Y6M7-8; Sequence=VSP_047841, VSP_047843, VSP_047848; Name=9; Synonyms=NBCn1-E; IsoId=Q9Y6M7-9; Sequence=VSP_047840, VSP_047844; Name=10; IsoId=Q9Y6M7-10; Sequence=VSP_047840, VSP_047843, VSP_047846, VSP_047847; Name=11; IsoId=Q9Y6M7-11; Sequence=VSP_047840, VSP_047844, VSP_047846, VSP_047847; Name=12; Synonyms=NBCn1-H; IsoId=Q9Y6M7-12; Sequence=VSP_047840, VSP_047843; Name=13; IsoId=Q9Y6M7-13; Sequence=VSP_047841, VSP_047844, VSP_047848; Name=14; IsoId=Q9Y6M7-14; Sequence=VSP_047841, VSP_047844, VSP_047846, VSP_047847
Alternative Sequence
1..450; Missing (in isoform 5); 1..90; Missing (in isoform 3 and isoform 4); 1..11; MERFRLEKKLP -> MEADGAGEQMRPLLTR (in isoform 6, isoform 9, isoform 10, isoform 11 and isoform 12); 1..11; MERFRLEKKLP -> MEADGAGEQMRPLLTRVTSR (in isoform 7, isoform 8, isoform 13 and isoform 14); 91..118; SQRVQFILGTEDDDEEHIPHDLFTEMDE -> MAVTQFIHFREEIMGNMFFIIIFSTKDK (in isoform 3 and isoform 4); 238..250; Missing (in isoform 8, isoform 10 and isoform 12); 251..374; Missing (in isoform 2, isoform 3, isoform 4, isoform 6, isoform 9, isoform 11, isoform 13 and isoform 14); 451..465; PAVLLTGLTEVPVPT -> MEVVEAEKIVLLTSA (in isoform 5); 581..582; LF -> VQ (in isoform 10, isoform 11 and isoform 14); 583..1214; Missing (in isoform 10, isoform 11 and isoform 14); 1188; S -> SVDPSIVNISDEMAKTAQWKALSMNTENAKVTRSNMS (in isoform 5, isoform 6, isoform 7, isoform 8 and isoform 13); 1189..1214; PDKPVSVKISFEDEPRKKYVDAETSL -> GDPSIGNISDEMAKTAQWKALSMNTENAKVTRSNMSPDKPVSVK (in isoform 3)

3D Structural Models

3D Structure
Electron microscopy (1)

Domain & Motif Annotations

Compositional Bias
1..12; Basic and acidic residues; 55..72; Basic residues; 73..85; Basic and acidic residues; 303..313; Pro residues; 314..332; Low complexity; 379..392; Polar residues; 563..572; Basic and acidic residues; 1144..1162; Basic and acidic residues
Motif
1211..1214; PDZ-binding
Domain (CC)
The PDZ-binding motif mediates interaction with the CFTR, NHERF1/EBP50 complex and probably with USH1C.
Region
1..22; Disordered; 52..93; Disordered; 289..346; Disordered; 362..408; Disordered; 552..572; Disordered; 1127..1214; Essential for cell membrane localization and transport activity; 1134..1136; CA2-binding; 1144..1169; Disordered; Q9Y6M7-6:1008..1131; Essential for cell membrane localization and transport activity
Protein Families
Anion exchanger (TC 2.A.31) family
Sequence Similarities
Belongs to the anion exchanger (TC 2.A.31) family.
Clinical Relevance
Antibody (2)
Interaction Protein (5)
ENSG00000108953ENSG00000143376ENSG00000164924ENSG00000166913ENSG00000170027
Interaction Count
5
Interaction Dataset (2)
biogrid_opencellintact_biogrid_opencell
Supporting Publications8
PMIDTitleRelated sentences
26801919Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis.No related sentences available
33709510Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.No related sentences available
37702715One-Pot Analytical Pipeline for Efficient and Sensitive Proteomic Analysis of Extracellular Vesicles.No related sentences available
38225453Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions.No related sentences available
39835386Comparison of nanoLC-MALDI-MS/MS with nanoLC-TIMS-MS/MS in the proteomic analysis of extracellular vesicles of bronchoalveolar lavage fluid.No related sentences available
40091455Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss.No related sentences available
40098346Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.No related sentences available
40750896The exosomal protein biomarkers auxiliary in diagnosis of interstitial lung disease.No related sentences available