Protein detail
ROBO1
Roundabout homolog 1 (Deleted in U twenty twenty) (H-Robo-1)
Entry name ROBO1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Roundabout homolog 1 (Deleted in U twenty twenty) (H-Robo-1)
Protein Class (2)
Predicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
898..918; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
DUTT1FLJ21882SAX3
Gene Description
Roundabout guidance receptor 1
Chromosome
3
Position
78597239-79767998
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificLate spermatidsBlood Cell Specificneutrophil
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (4)
Biological Process (3)
Reactome (8)
- R-hsa-428540 activation of rac1
- R-hsa-428543 inactivation of cdc42 and rac1
- R-hsa-9675108 nervous system development
- R-hsa-373752 netrin 1 signaling
- R-hsa-428542 regulation of commissural axon pathfinding by slit and robo
- R-hsa-9010553 regulation of expression of slits and robos
- R-hsa-428890 role of abl in robo slit signaling
- R-hsa-376176 signaling by robo receptors
Mediation Categories (3)
Adhesion and uptake mediationImmune mediationReceptor-signaling mediation
Relations & Evidence65
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ROBO1 | ABL1 | P00519 | Y | 1,038 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperdbPTMPhosphoSitePhosphoSite_ProtMapper | dbPTM:10892742 |
| ROBO1 | ABL1 | P00519 | Y | 1,073 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperdbPTMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:10892742ProtMapper:10892742dbPTM:10892742 |
| ROBO1 | ABL1 | P00519 | Y | 1,114 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperdbPTMPhosphoSitePhosphoSite_ProtMapper | dbPTM:10892742 |
Ligand-Receptor Signaling (56)
56 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellPhoneDB | Yes | Yes | |||
| receptor | receptor | GO_Intercell | Yes | Yes | |||
| receptor | receptor | HPMR | Yes | Yes | |||
| receptor | receptor | ICELLNET | Yes | Yes | |||
| receptor | receptor | CellChatDB | Yes | Yes | |||
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | Surfaceome | Yes | Yes | |||
| receptor | receptor | Ramilowski2015 | Yes | Yes | |||
| receptor | receptor | LRdb | Yes | Yes | |||
| ig_like | receptor | Almen2009 | Yes | Yes |
Page 1 of 6Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ABL1 | P00519 | ROBO1 | Q9Y6N7 | Yes | Yes | Yes | SPIKEPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDdbPTMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperSPIKE_LC | SPIKE:17618275SPIKE_LC:20841568ProtMapper:10892742dbPTM:10892742SPIKE_LC:17618275SIGNOR:10892742HPRD:10892742PhosphoSite:10892742SPIKE:20841568 |
Protein Complex Composition (4)
4 records.
Sequence, Structure & Domains
Sequences
Length
1,651
Mass
180,930
Sequence
MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSGANHGESDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNISEPAAQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQNKLNKDYRANDTVPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPPAHPPPHSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAVMQKTRPAKKLKHQPGHLRRETYTDDLPPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQVVDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q9Y6N7-1; Sequence=Displayed; Name=2; IsoId=Q9Y6N7-2; Sequence=VSP_010646; Name=3; IsoId=Q9Y6N7-3; Sequence=VSP_010643, VSP_010644, VSP_010645; Name=4; IsoId=Q9Y6N7-4; Sequence=VSP_010643, VSP_010644; Name=5; IsoId=Q9Y6N7-5; Sequence=VSP_043881, VSP_010645, VSP_043882; Name=6; IsoId=Q9Y6N7-6; Sequence=VSP_043881, VSP_010645, VSP_043882, VSP_046084
Alternative Sequence
1..57; MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT -> MIAEPAHFYLFGLICLCS (in isoform 5 and isoform 6); 1..39; Missing (in isoform 3 and isoform 4); 40..57; HGTPIPTSDNDDNSLGYT -> MIAEPAHFYLFGLICLCS (in isoform 3 and isoform 4); 348; Q -> QVGS (in isoform 3, isoform 5 and isoform 6); 543; Q -> QGKVN (in isoform 2); 938..946; Missing (in isoform 5 and isoform 6); 1013..1067; Missing (in isoform 6)
3D Structural Models
Turn
111..113; 506..508
Helix
232..234; 261..266; 322..324; 420..422; 517..519; 666..675; 719..721; 803..805; 822..824; 880..883
Beta Strand
66..72; 77..79; 85..87; 90..95; 98..103; 118..121; 127..131; 135..137; 143..151; 154..157; 161..165; 167..174; 179..182; 187..190; 196..198; 201..206; 209..211; 213..215; 218..221; 224..229; 236..244; 247..250; 254..259; 271..274; 279..281; 284..289; 292..300; 306..309; 315..317; 326..333; 338..355; 360..363; 368..370; 373..378; 381..386; 395..397; 405..407; 413..415; 424..431; 436..446; 456..459; 464..467; 472..475; 477..479; 485..490; 502..504; 509..512; 521..529; 532..543; 676..680; 687..689; 691..699; 706..715; 724..728; 735..738; 746..755; 766..769; 780..786; 789..791; 794..799; 812..818; 826..831; 836..839; 848..854; 867..869
3D Structure
NMR spectroscopy (1); X-ray crystallography (11)
Domain & Motif Annotations
Compositional Bias
44..56; Polar residues; 1137..1146; Polar residues; 1147..1163; Low complexity; 1186..1196; Pro residues; 1255..1269; Polar residues; 1281..1293; Basic and acidic residues; 1296..1307; Pro residues; 1322..1336; Acidic residues; 1384..1397; Low complexity; 1438..1451; Polar residues; 1459..1470; Basic residues; 1480..1490; Pro residues; 1516..1541; Basic and acidic residues; 1549..1573; Basic and acidic residues; 1592..1601; Polar residues; 1602..1614; Low complexity; 1642..1651; Acidic residues
Domain (FT)
68..164; Ig-like C2-type 1; 170..257; Ig-like C2-type 2; 262..346; Ig-like C2-type 3; 351..446; Ig-like C2-type 4; 455..541; Ig-like C2-type 5; 563..657; Fibronectin type-III 1; 676..773; Fibronectin type-III 2; 778..874; Fibronectin type-III 3
Region
33..57; Disordered; 1124..1202; Disordered; 1224..1337; Disordered; 1352..1397; Disordered; 1420..1651; Disordered
Protein Families (2)
- Immunoglobulin superfamily
- ROBO family
Sequence Similarities
Belongs to the immunoglobulin superfamily. ROBO family.
Clinical Relevance
Disease Involvement (3)
Disease variantDwarfismIntellectual disability
Related Diseases (2)
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |