Protein detail

ROBO1

Roundabout homolog 1 (Deleted in U twenty twenty) (H-Robo-1)

Entry name ROBO1	UniProt ID Q9Y6N7	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 1	Protein classification Predicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Roundabout homolog 1 (Deleted in U twenty twenty) (H-Robo-1)

Protein Class (2)

Predicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins

Transmembrane

898..918; Helical

Transmembrane Count

Ensembl

ENSG00000169855

Entrez Gene Symbol

ROBO1

Gene Synonym (3)

DUTT1FLJ21882SAX3

Gene Description

Roundabout guidance receptor 1

Chromosome

Position

78597239-79767998

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Cell SpecificLate spermatidsBlood Cell Specificneutrophil

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (6)

Molecular Function (4)

Biological Process (3)

KEGG (2)

Reactome (8)

Mediation Categories (3)

Adhesion and uptake mediationImmune mediationReceptor-signaling mediation

Relations & Evidence65

Enzyme-Mediated Modification (3)

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
ROBO1	ABL1	P00519	Y	1,038	phosphorylation	PhosphoSite_MIMPMIMPProtMapperdbPTMPhosphoSitePhosphoSite_ProtMapper	dbPTM:10892742
ROBO1	ABL1	P00519	Y	1,073	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperdbPTMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:10892742 ProtMapper:10892742 dbPTM:10892742
ROBO1	ABL1	P00519	Y	1,114	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPProtMapperdbPTMPhosphoSitePhosphoSite_ProtMapper	dbPTM:10892742

Ligand-Receptor Signaling (56)

56 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellPhoneDB	No	Yes	No	Yes	No
receptor	receptor	GO_Intercell	No	Yes	No	Yes	No
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	CellChatDB	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	LRdb	No	Yes	No	Yes	No
ig_like	receptor	Almen2009	No	Yes	No	Yes	No

Page 1 of 6Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ABL1	P00519	ROBO1	Q9Y6N7	Yes	Yes	Yes	SPIKEPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDdbPTMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapperSPIKE_LC	SPIKE:17618275 SPIKE_LC:20841568 ProtMapper:10892742 dbPTM:10892742 SPIKE_LC:17618275 SIGNOR:10892742 HPRD:10892742 PhosphoSite:10892742 SPIKE:20841568

Protein Complex Composition (4)

4 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ROBO1 SLIT2	O94813 Q9Y6N7	1:1	PDB	PDB:2v9t
GDPD5 GPD2 ROBO1 TRIM15	P43304 Q8WTR4 Q9C019 Q9Y6N7	0:0:0:0	hu.MAP2
MAPK12 ROBO1	P53778 Q9Y6N7	0:0	Havugimana2012	Havugimana2012:C_24
ROBO1	Q9Y6N7	2	PDB	PDB:3wihPDB:6a79PDB:6a78

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	R SequencingMass spectrometry	3	36064647 41068253 39207047

Sequence, Structure & Domains14

Sequences

Length

1,651

Mass

180,930

Sequence

MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSGANHGESDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNISEPAAQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQNKLNKDYRANDTVPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPPAHPPPHSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAVMQKTRPAKKLKHQPGHLRRETYTDDLPPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQVVDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES

Alternative Products

Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q9Y6N7-1; Sequence=Displayed; Name=2; IsoId=Q9Y6N7-2; Sequence=VSP_010646; Name=3; IsoId=Q9Y6N7-3; Sequence=VSP_010643, VSP_010644, VSP_010645; Name=4; IsoId=Q9Y6N7-4; Sequence=VSP_010643, VSP_010644; Name=5; IsoId=Q9Y6N7-5; Sequence=VSP_043881, VSP_010645, VSP_043882; Name=6; IsoId=Q9Y6N7-6; Sequence=VSP_043881, VSP_010645, VSP_043882, VSP_046084

Alternative Sequence

1..57; MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYT -> MIAEPAHFYLFGLICLCS (in isoform 5 and isoform 6); 1..39; Missing (in isoform 3 and isoform 4); 40..57; HGTPIPTSDNDDNSLGYT -> MIAEPAHFYLFGLICLCS (in isoform 3 and isoform 4); 348; Q -> QVGS (in isoform 3, isoform 5 and isoform 6); 543; Q -> QGKVN (in isoform 2); 938..946; Missing (in isoform 5 and isoform 6); 1013..1067; Missing (in isoform 6)

3D Structural Models

Turn

111..113; 506..508

Helix

232..234; 261..266; 322..324; 420..422; 517..519; 666..675; 719..721; 803..805; 822..824; 880..883

Beta Strand

66..72; 77..79; 85..87; 90..95; 98..103; 118..121; 127..131; 135..137; 143..151; 154..157; 161..165; 167..174; 179..182; 187..190; 196..198; 201..206; 209..211; 213..215; 218..221; 224..229; 236..244; 247..250; 254..259; 271..274; 279..281; 284..289; 292..300; 306..309; 315..317; 326..333; 338..355; 360..363; 368..370; 373..378; 381..386; 395..397; 405..407; 413..415; 424..431; 436..446; 456..459; 464..467; 472..475; 477..479; 485..490; 502..504; 509..512; 521..529; 532..543; 676..680; 687..689; 691..699; 706..715; 724..728; 735..738; 746..755; 766..769; 780..786; 789..791; 794..799; 812..818; 826..831; 836..839; 848..854; 867..869

3D Structure

NMR spectroscopy (1); X-ray crystallography (11)

Domain & Motif Annotations

Compositional Bias

44..56; Polar residues; 1137..1146; Polar residues; 1147..1163; Low complexity; 1186..1196; Pro residues; 1255..1269; Polar residues; 1281..1293; Basic and acidic residues; 1296..1307; Pro residues; 1322..1336; Acidic residues; 1384..1397; Low complexity; 1438..1451; Polar residues; 1459..1470; Basic residues; 1480..1490; Pro residues; 1516..1541; Basic and acidic residues; 1549..1573; Basic and acidic residues; 1592..1601; Polar residues; 1602..1614; Low complexity; 1642..1651; Acidic residues

Domain (FT)

68..164; Ig-like C2-type 1; 170..257; Ig-like C2-type 2; 262..346; Ig-like C2-type 3; 351..446; Ig-like C2-type 4; 455..541; Ig-like C2-type 5; 563..657; Fibronectin type-III 1; 676..773; Fibronectin type-III 2; 778..874; Fibronectin type-III 3

Region

33..57; Disordered; 1124..1202; Disordered; 1224..1337; Disordered; 1352..1397; Disordered; 1420..1651; Disordered

Protein Families (2)

Immunoglobulin superfamily
ROBO family

Sequence Similarities

Belongs to the immunoglobulin superfamily. ROBO family.

Clinical Relevance2

Disease Involvement (3)

Disease variantDwarfismIntellectual disability

Antibody (3)

CAB013524 HPA052968 HPA074461

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available