Protein detail
TNR11
Tumor necrosis factor receptor superfamily member 11A (Osteoclast differentiation factor receptor) (ODFR) (Receptor activator of NF-KB) (CD antigen CD265)
Entry name TNR11 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Tumor necrosis factor receptor superfamily member 11A (Osteoclast differentiation factor receptor) (ODFR) (Receptor activator of NF-KB) (CD antigen CD265)
Protein Class (5)
CD markersDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (5)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- CD markers
- Human disease related genes:Musculoskeletal diseases:Skeletal diseases
- Disease related genes
Transmembrane
213..233; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (7)
CD265FEOLOH18CR1ODFRPDB2RANKTRANCE-R
Gene Description
TNF receptor superfamily member 11a
Chromosome
18
Position
62325287-62391288
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization4
Cell SpecificAlveolar cells type 2Single-Nuclei Brain Specificependymal cellSecretome LocationIntracellular and membraneSecretome FunctionNo annotated function
Function & Pathway7
Protein Function (5)
- Predicted intracellular proteins
- Human disease related genes:Congenital malformations:Congenital malformations of the musculoskeletal system
- CD markers
- Human disease related genes:Musculoskeletal diseases:Skeletal diseases
- Disease related genes
Cellular Component (4)
Molecular Function (6)
Biological Process (3)
KEGG (5)
Reactome (3)
Mediation Categories (4)
Fusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence68
Ligand-Receptor Signaling (64)
64 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellPhoneDB | No | Yes | No | Yes | No |
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellChatDB | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | Guide2Pharma | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
Page 1 of 7Next
Regulatory Interaction Network (2)
2 records.
Protein Complex Composition (1)
Sequence, Structure & Domains10
Sequences
Length
616
Mass
66,034
Sequence
MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGKALTANLWHWINEACGRLSGDKESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMCYPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQLLFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSESCNCTEPLCRTDWTPMSSENYLQKEVDSGHCPHWAASPSPNWADVCTGCRNPPGEDCEPLVGSPKRGPLPQCAYGMGLPPEEEASRTEARDQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLREPEKASRPVQEQGGAKA
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q9Y6Q6-1; Sequence=Displayed; Name=2; Synonyms=delta7,8,9; IsoId=Q9Y6Q6-2; Sequence=VSP_046901; Name=3; Synonyms=delta8,9; IsoId=Q9Y6Q6-3; Sequence=VSP_054180; Name=4; Synonyms=delta9; IsoId=Q9Y6Q6-4; Sequence=VSP_054181, VSP_054182; Name=5; Synonyms=exon9a; IsoId=Q9Y6Q6-5; Sequence=VSP_054183; Name=RANK-e5a; IsoId=Q9Y6Q6-6; Sequence=VSP_054179
Alternative Sequence
143..157; LQLNKDTVCKPCLAG -> C (in isoform RANK-e5a); 206..522; Missing (in isoform 2); 244..522; Missing (in isoform 3); 263; S -> M (in isoform 4); 264..616; Missing (in isoform 4); 523..616; GNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLREPEKASRPVQEQGGAKA -> D (in isoform 5)
3D Structural Models
Beta Strand
345..348
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
483..493; Basic and acidic residues; 499..508; Low complexity; 524..536; Polar residues; 570..580; Basic and acidic residues
Repeat
34..68; TNFR-Cys 1; 71..112; TNFR-Cys 2; 114..151; TNFR-Cys 3; 154..194; TNFR-Cys 4
Region
468..536; Disordered; 544..549; Required for interaction with EEIG1 and osteoclast differentiation; 556..616; Disordered
Clinical Relevance6
Disease Involvement (3)
DeafnessDisease variantOsteopetrosis
Drugs (8)
Interaction Protein
ENSG00000127191
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |