Protein detail

ICOS

Inducible T-cell costimulator (Activation-inducible lymphocyte immunomediatory molecule) (CD antigen CD278)

Entry name ICOS	UniProt ID Q9Y6W8	EVMP confidence score 0.38
Supporting publications (n) 5	Transmembrane count 1	Protein classification CD markersDisease related genesHuman disease related genesPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Inducible T-cell costimulator (Activation-inducible lymphocyte immunomediatory molecule) (CD antigen CD278)

Protein Class (4)

CD markersDisease related genesHuman disease related genesPredicted membrane proteins

Protein Function (3)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
CD markers

Transmembrane

141..161; Helical

Transmembrane Count

Ensembl

ENSG00000163600

Entrez Gene Symbol

ICOS

Gene Synonym (2)

AILIMCD278

Gene Description

Inducible T cell costimulator

Chromosome

Position

203936763-203961577

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Function & Pathway6

Protein Function (3)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
CD markers

Cellular Component (2)

Molecular Function

GO:0005515 protein binding

KEGG (4)

Reactome (10)

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationImmune mediationReceptor-signaling mediation

Relations & Evidence63

Ligand-Receptor Signaling (46)

46 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellPhoneDB	No	Yes	Yes	Yes	No
receptor	receptor	ICELLNET	No	Yes	Yes	Yes	No
receptor	receptor	CellChatDB	No	Yes	Yes	Yes	No
receptor	receptor	CellTalkDB	No	Yes	Yes	Yes	No
receptor	receptor	Baccin2019	No	Yes	Yes	Yes	No
checkpoint	receptor	ICELLNET	No	Yes	Yes	Yes	No
checkpoint_b7	receptor	ICELLNET	No	Yes	Yes	Yes	No
receptor	receptor	OmniPath	No	Yes	Yes	Yes	No
extracellular	extracellular	OmniPath	No	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	connectomeDB2020	Yes	No	Yes	Yes	No

Page 1 of 5Next

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ICOS	Q9Y6W8	P85A	P27986	Yes	Yes	No	WangNetPathSIGNORHINTIntActInnateDBSPIKE_LCSPIKE	InnateDB:18641334 NetPath:16217039 SIGNOR:18641334 HINT:27135603 SPIKE_LC:16217039 IntAct:27135603 SPIKE:16217039 HINT:18641334
ICOSL	O75144	ICOS	Q9Y6W8	Yes	Yes	No	iTALKKEGG-MEDICUSICELLNETSIGNORHINTCellPhoneDB_CellinkerUniProt_LRdbCellChatDBHPRDWojtowicz2020IntActWangCellPhoneDBBioGRIDBaccin2019CellinkerCellTalkDBNetPathconnectomeDB2020SPIKE_LCLRdbSPIKE	CellTalkDB:23954143 HPRD:10657606 IntAct:16951355 CellChatDB:23954143 HINT:11956294 SIGNOR:27559335 SPIKE_LC:10657606 NetPath:10657606 ICELLNET:14599850 BioGRID:11956294 Cellinker:23954143 Cellinker:25769613 Cellinker:29879883 HINT:16951355 connectomeDB2020:14599850 SPIKE:10657606 connectomeDB2020:23954143 ICELLNET:23954143 HINT:33033255 Cellinker:21955433 IntAct:11956294 HPRD:11023515 HPRD:11956294

Protein Complex Composition (14)

14 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
MIB complex	APOO APOOL CHCHD3 CHCHD6 DNAJC11 IMMT MICOS10 MICOS13 MTX1 MTX2 SAMM50	O75431 Q13505 Q16891 Q5TGZ0 Q5XKP0 Q6UXV4 Q9BRQ6 Q9BUR5 Q9NVH1 Q9NX63 Q9Y512	0:0:0:0:0:0:0:0:0:0:0	CORUM	CORUM:6249	26477565
MICOS complex	APOO APOOL CHCHD3 CHCHD6 IMMT MICOS10 MICOS13	Q16891 Q5TGZ0 Q5XKP0 Q6UXV4 Q9BRQ6 Q9BUR5 Q9NX63	1:1:1:1:1:1:1	CORUMComplexPortal	CORUM:6255intact:EBI-25823797	30496485 26477565 31387448 25997101 14755292
MINOS complex	CHCHD3 IMMT MICOS10	Q16891 Q5TGZ0 Q9NX63	0:0:0	CORUM	CORUM:6132	23676277
	IMMT MICOS10 MTX1 MTX2 SAMM50 TIMM23 TOMM20 TOMM22 TOMM40 TOMM7 TOMM70 UBC VDAC1	O14925 O75431 O94826 O96008 P0CG48 P21796 Q13505 Q15388 Q16891 Q5TGZ0 Q9NS69 Q9P0U1 Q9Y512	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8353
	IMMT MICOS10 MTHFD2 MTX1 MTX2 SAMM50 TOMM20 TOMM22 TOMM40 TOMM7 UBC VDAC1	O75431 O96008 P0CG48 P13995 P21796 Q13505 Q15388 Q16891 Q5TGZ0 Q9NS69 Q9P0U1 Q9Y512	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5949
	HSPA8 IMMT MICOS10 MTX1 MTX2 PPCS SAMM50 UBC	O75431 P0CG48 P11142 Q13505 Q16891 Q5TGZ0 Q9HAB8 Q9Y512	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4220
	IMMT MAPK1 MICOS10 MTHFD2 MTX1 MTX2 SAMM50 UBC	O75431 P0CG48 P13995 P28482 Q13505 Q16891 Q5TGZ0 Q9Y512	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6024
	IMMT MICOS10 MTX1 MTX2 SAMM50 SUCLG1 SUCLG2 UBC	O75431 P0CG48 P53597 Q13505 Q16891 Q5TGZ0 Q96I99 Q9Y512	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6591
	IMMT MICOS10 MTX1 MTX2 SAMM50 SLC25A15 UBC	O75431 P0CG48 Q13505 Q16891 Q5TGZ0 Q9Y512 Q9Y619	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3963
	IMMT MICOS10 MTX1 MTX2 PHB1 PHB2 SAMM50 SERINC3 VDAC3	O75431 P35232 Q13505 Q13530 Q16891 Q5TGZ0 Q99623 Q9Y277 Q9Y512	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7754

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry [LTQ-FT Ultra]Mass spectrometry	1	38716512

Sequence, Structure & Domains9

Sequences

Length

199

Mass

22,625

Sequence

MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y6W8-1; Sequence=Displayed; Name=2; IsoId=Q9Y6W8-2; Sequence=VSP_010788

Alternative Sequence

168..199; KYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL -> M (in isoform 2)

3D Structural Models

Helix

101..103

Beta Strand

31..33; 35..43; 50..57; 60..69; 75..78; 84..87; 89..96; 106..118; 120..127

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Domain (FT)

30..132; Ig-like V-type

Clinical Relevance7

Related Diseases (2)

Lupus erythematosus Solid tumour/cancer

Biomarker

Phase 1; Phase 2

Drugs (3)

VOPRATELIMAB MEDI-570 FELADILIMAB

Antibody (2)

CAB032575 HPA034865

Interaction Protein

ENSG00000160223

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications5

PMID	Title	Abstract
24505114	Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform.	These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4.
31588238	Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment.	No abstract available
32231660	Natural-Killer-Derived Extracellular Vesicles: Immune Sensors and Interactors.	No abstract available
38490958	Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available