Protein detail
ICOS
Inducible T-cell costimulator (Activation-inducible lymphocyte immunomediatory molecule) (CD antigen CD278)
Entry name ICOS | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 5 | Transmembrane count 1 | Protein classification CD markersDisease related genesHuman disease related genesPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Inducible T-cell costimulator (Activation-inducible lymphocyte immunomediatory molecule) (CD antigen CD278)
Protein Class (4)
CD markersDisease related genesHuman disease related genesPredicted membrane proteins
Protein Function (3)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- CD markers
Transmembrane
141..161; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
AILIMCD278
Gene Description
Inducible T cell costimulator
Chromosome
2
Position
203936763-203961577
Supporting publications (n)
5
EVMP confidence score
0.38
Fluorescence & Localization1
Function & Pathway6
Protein Function (3)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- CD markers
Cellular Component (2)
Molecular Function
KEGG (4)
Reactome (10)
- R-hsa-1280218 adaptive immune system
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-9927354 co stimulation by icos
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-199418 negative regulation of the pi3k akt network
- R-hsa-9725371 nuclear events stimulated by alk signaling in cancer
- R-hsa-2219528 pi3k akt signaling in cancer
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-9700206 signaling by alk in cancer
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationImmune mediationReceptor-signaling mediation
Relations & Evidence63
Ligand-Receptor Signaling (46)
46 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_predicted | transmembrane | OmniPath | No | No | Yes | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | No |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ICOS | Q9Y6W8 | P85A | P27986 | Yes | Yes | No | WangNetPathSIGNORHINTIntActInnateDBSPIKE_LCSPIKE | InnateDB:18641334NetPath:16217039SIGNOR:18641334HINT:27135603SPIKE_LC:16217039IntAct:27135603SPIKE:16217039HINT:18641334 |
| ICOSL | O75144 | ICOS | Q9Y6W8 | Yes | Yes | No | iTALKKEGG-MEDICUSICELLNETSIGNORHINTCellPhoneDB_CellinkerUniProt_LRdbCellChatDBHPRDWojtowicz2020IntActWangCellPhoneDBBioGRIDBaccin2019CellinkerCellTalkDBNetPathconnectomeDB2020SPIKE_LCLRdbSPIKE | CellTalkDB:23954143HPRD:10657606IntAct:16951355CellChatDB:23954143HINT:11956294SIGNOR:27559335SPIKE_LC:10657606NetPath:10657606ICELLNET:14599850BioGRID:11956294Cellinker:23954143Cellinker:25769613Cellinker:29879883HINT:16951355connectomeDB2020:14599850SPIKE:10657606connectomeDB2020:23954143ICELLNET:23954143HINT:33033255Cellinker:21955433IntAct:11956294HPRD:11023515HPRD:11956294 |
Protein Complex Composition (14)
14 records.
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 1 | 38716512 |
Sequence, Structure & Domains9
Sequences
Length
199
Mass
22,625
Sequence
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y6W8-1; Sequence=Displayed; Name=2; IsoId=Q9Y6W8-2; Sequence=VSP_010788
Alternative Sequence
168..199; KYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL -> M (in isoform 2)
3D Structural Models
Helix
101..103
Beta Strand
31..33; 35..43; 50..57; 60..69; 75..78; 84..87; 89..96; 106..118; 120..127
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Domain (FT)
30..132; Ig-like V-type
Clinical Relevance7
Related Diseases (2)
Biomarker
Phase 1; Phase 2
Drugs (3)
Interaction Protein
ENSG00000160223
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications5
| PMID | Title | Abstract |
|---|---|---|
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 31588238 | Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment. | No abstract available |
| 32231660 | Natural-Killer-Derived Extracellular Vesicles: Immune Sensors and Interactors. | No abstract available |
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |