Protein detail

CLM7

CMRF35-like molecule 7 (CLM-7) (CD300 antigen-like family member B) (CMRF35-A2) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-Ig-like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM-5) (CD antigen CD300b)

Entry name CLM7	UniProt ID A8K4G0	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Protein Function (2)

CD markers
Predicted intracellular proteins

Transmembrane

152..172; Helical

Transmembrane Count

Ensembl

ENSG00000178789

Entrez Gene Symbol

CD300LB

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Cell SpecificEsophageal apical cells

Function & Pathway6

Protein Function (2)

CD markers
Predicted intracellular proteins

Cellular Component

GO:0005886 plasma membrane

Molecular Function (3)

Biological Process (3)

Reactome (4)

Mediation Categories

Immune mediation

Relations & Evidence32

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
CD300LB	FYN	P06241	Y	188	phosphorylation	SIGNORProtMapperdbPTMPhosphoSitePhosphoSite_ProtMapper	dbPTM:16920917 dbPTM:17928527 SIGNOR:16920917

Ligand-Receptor Signaling (27)

27 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
cell_surface	cell_surface	connectomeDB2020	No	No	No	Yes	No
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
receptor	receptor	connectomeDB2020	No	Yes	No	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No

Page 3 of 3Previous

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CLM7	A8K4G0	TYOBP	O43914	Yes	Yes	No	InnateDBSIGNOR	InnateDB:16920917 SIGNOR:20959446
CLM7	A8K4G0	GRB2	P62993	Yes	Yes	No	InnateDBSIGNOR	InnateDB:16920917 SIGNOR:20959446
FYN	P06241	CLM7	A8K4G0	Yes	Yes	No	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperdbPTMInnateDBSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	dbPTM:17928527 PhosphoSite:17928527 PhosphoSite:16920917 SIGNOR:16920917 InnateDB:16920917 dbPTM:16920917 ProtMapper:16920917

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Western blotting	2	38731868 38082559

Sequence, Structure & Domains6

Sequences

Length

201

Mass

22,689

Sequence

MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT

Domain & Motif Annotations

Domain (FT)

18..120; Ig-like V-type

Protein Families

CD300 family

Sequence Similarities

Belongs to the CD300 family.

Supporting Publications2

PMID	Title	Abstract
40784529	Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine.	No abstract available
41216884	Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation.	No abstract available