Protein detail
CLM7
CMRF35-like molecule 7 (CLM-7) (CD300 antigen-like family member B) (CMRF35-A2) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-Ig-like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM-5) (CD antigen CD300b)
Entry name CLM7 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CMRF35-like molecule 7 (CLM-7) (CD300 antigen-like family member B) (CMRF35-A2) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-Ig-like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM-5) (CD antigen CD300b)
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Transmembrane
152..172; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificEsophageal apical cells
Function & Pathway
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Cellular Component
Molecular Function (3)
Biological Process (3)
Reactome (4)
Mediation Categories
Immune mediation
Relations & Evidence32
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD300LB | FYN | P06241 | Y | 188 | phosphorylation | SIGNORProtMapperdbPTMPhosphoSitePhosphoSite_ProtMapper | dbPTM:16920917dbPTM:17928527SIGNOR:16920917 |
Ligand-Receptor Signaling (27)
27 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | connectomeDB2020 | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | connectomeDB2020 | Yes | Yes | |||
| transmembrane | transmembrane_predicted | Phobius | Yes |
Page 3 of 3Previous
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CLM7 | A8K4G0 | TYOBP | O43914 | Yes | Yes | InnateDBSIGNOR | InnateDB:16920917SIGNOR:20959446 | |
| CLM7 | A8K4G0 | GRB2 | P62993 | Yes | Yes | InnateDBSIGNOR | InnateDB:16920917SIGNOR:20959446 | |
| FYN | P06241 | CLM7 | A8K4G0 | Yes | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperdbPTMInnateDBSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | dbPTM:17928527PhosphoSite:17928527PhosphoSite:16920917SIGNOR:16920917InnateDB:16920917dbPTM:16920917ProtMapper:16920917 |
Sequence, Structure & Domains
Sequences
Length
201
Mass
22,689
Sequence
MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT
Domain & Motif Annotations
Domain (FT)
18..120; Ig-like V-type
Protein Families
CD300 family
Sequence Similarities
Belongs to the CD300 family.
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 40784529 | Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine. | No related sentences available |
| 41216884 | Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation. | No related sentences available |