Protein detail

P2Y10

Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)

Entry name P2Y10	UniProt ID O00398	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 7	Protein classification G-protein coupled receptorsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)

Protein Class (2)

G-protein coupled receptorsPredicted membrane proteins

Protein Function (2)

G-protein coupled receptors:Adenosine and adenine nucleotide receptors
G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

40..60; Helical; Name=1; 69..89; Helical; Name=2; 104..124; Helical; Name=3; 150..170; Helical; Name=4; 194..214; Helical; Name=5; 245..265; Helical; Name=6; 289..309; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000078589

Entrez Gene Symbol

P2RY10

Gene Synonym

P2Y10

Gene Description

P2Y receptor family member 10

Chromosome

Position

78945332-78963727

Supporting publications (n)

EVMP confidence score

0.25

Function & Pathway7

Protein Function (2)

G-protein coupled receptors:Adenosine and adenine nucleotide receptors
G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component

GO:0005886 plasma membrane

Molecular Function

GO:0004930 G protein-coupled receptor activity

Biological Process (3)

KEGG

hsa04080 Neuroactive ligand-receptor interaction

Reactome (6)

Mediation Categories (2)

Clinical-translation mediationReceptor-signaling mediation

Relations & Evidence46

Ligand-Receptor Signaling (38)

38 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
gpcr	receptor	Surfaceome	No	Yes	No	Yes	No
class_a_rhodopsin	receptor	GPCRdb	No	Yes	No	Yes	No
class_a_rhodopsin_orphan	receptor	GPCRdb	No	Yes	No	Yes	No
class_a_rhodopsin_orphan_class_a_orphans	receptor	GPCRdb	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	HPMR	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No

Page 2 of 4Previous Next

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
P2Y10	O00398	GNAI3	P08754	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNAO	P09471	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNAZ	P19086	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNA14	O95837	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNAI1	P63096	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNA13	Q14344	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNA12	Q03113	Yes	Yes	No	SIGNOR	SIGNOR:31160049

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blotting；RNA Sequencing；Flow cytometry；ELISA	1	40730843

Sequence, Structure & Domains8

Sequences

Length

339

Mass

38,774

Sequence

MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG

3D Structural Models

Helix

33..59; 70..84; 88..96; 103..136; 140..142; 146..163; 166..170; 182..184; 192..206; 208..223; 235..270; 277..294; 297..306

Beta Strand

226..228; 310..312

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance3

Drug Targets

Literature-reported target

Drugs

MC-1

Antibody (2)

HPA036757 HPA065766

Supporting Publications1

PMID	Title	Abstract
37427430	Multiomics of Tissue Extracellular Vesicles Identifies Unique Modulators of Atherosclerosis and Calcific Aortic Valve Stenosis.	No abstract available