Protein detail
P2Y10
Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)
Entry name P2Y10 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification G-protein coupled receptorsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)
Protein Class (2)
G-protein coupled receptorsPredicted membrane proteins
Protein Function (2)
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
40..60; Helical; Name=1; 69..89; Helical; Name=2; 104..124; Helical; Name=3; 150..170; Helical; Name=4; 194..214; Helical; Name=5; 245..265; Helical; Name=6; 289..309; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
P2Y10
Gene Description
P2Y receptor family member 10
Chromosome
X
Position
78945332-78963727
Supporting publications (n)
1
EVMP confidence score
0.40
Function & Pathway
Protein Function (2)
- G-protein coupled receptors:Adenosine and adenine nucleotide receptors
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Molecular Function
Biological Process (3)
Reactome (6)
Mediation Categories (2)
Clinical-translation mediationReceptor-signaling mediation
Relations & Evidence46
Ligand-Receptor Signaling (38)
38 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | GO_Intercell | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes |
Regulatory Interaction Network (7)
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| P2Y10 | O00398 | GNAI3 | P08754 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| P2Y10 | O00398 | GNAO | P09471 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| P2Y10 | O00398 | GNAZ | P19086 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| P2Y10 | O00398 | GNA14 | O95837 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| P2Y10 | O00398 | GNAI1 | P63096 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| P2Y10 | O00398 | GNA13 | Q14344 | Yes | Yes | SIGNOR | SIGNOR:31160049 | |
| P2Y10 | O00398 | GNA12 | Q03113 | Yes | Yes | SIGNOR | SIGNOR:31160049 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western blotting;RNA Sequencing;Flow cytometry;ELISA | 1 | 40730843 |
Sequence, Structure & Domains
Sequences
Length
339
Mass
38,774
Sequence
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
3D Structural Models
Helix
33..59; 70..84; 88..96; 103..136; 140..142; 146..163; 166..170; 182..184; 192..206; 208..223; 235..270; 277..294; 297..306
Beta Strand
226..228; 310..312
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 37427430 | Multiomics of Tissue Extracellular Vesicles Identifies Unique Modulators of Atherosclerosis and Calcific Aortic Valve Stenosis. | No related sentences available |