Protein detail

P2Y10

Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)

Entry name P2Y10	UniProt ID O00398	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 7	Protein classification G-protein coupled receptorsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)

Protein Class (2)

G-protein coupled receptorsPredicted membrane proteins

Protein Function (2)

G-protein coupled receptors:Adenosine and adenine nucleotide receptors
G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

40..60; Helical; Name=1; 69..89; Helical; Name=2; 104..124; Helical; Name=3; 150..170; Helical; Name=4; 194..214; Helical; Name=5; 245..265; Helical; Name=6; 289..309; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000078589

Entrez Gene Symbol

P2RY10

Gene Synonym

P2Y10

Gene Description

P2Y receptor family member 10

Chromosome

Position

78945332-78963727

Supporting publications (n)

EVMP confidence score

0.25

Function & Pathway7

Protein Function (2)

G-protein coupled receptors:Adenosine and adenine nucleotide receptors
G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component

GO:0005886 plasma membrane

Molecular Function

GO:0004930 G protein-coupled receptor activity

Biological Process (3)

KEGG

hsa04080 Neuroactive ligand-receptor interaction

Reactome (6)

Mediation Categories (2)

Clinical-translation mediationReceptor-signaling mediation

Relations & Evidence46

Ligand-Receptor Signaling (38)

38 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	GO_Intercell	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	CSPA	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	No	Yes	No

Page 3 of 4Previous Next

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
P2Y10	O00398	GNAI3	P08754	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNAO	P09471	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNAZ	P19086	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNA14	O95837	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNAI1	P63096	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNA13	Q14344	Yes	Yes	No	SIGNOR	SIGNOR:31160049
P2Y10	O00398	GNA12	Q03113	Yes	Yes	No	SIGNOR	SIGNOR:31160049

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blotting；RNA Sequencing；Flow cytometry；ELISA	1	40730843

Sequence, Structure & Domains8

Sequences

Length

339

Mass

38,774

Sequence

MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG

3D Structural Models

Helix

33..59; 70..84; 88..96; 103..136; 140..142; 146..163; 166..170; 182..184; 192..206; 208..223; 235..270; 277..294; 297..306

Beta Strand

226..228; 310..312

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance3

Drug Targets

Literature-reported target

Drugs

MC-1

Antibody (2)

HPA036757 HPA065766

Supporting Publications1

PMID	Title	Abstract
37427430	Multiomics of Tissue Extracellular Vesicles Identifies Unique Modulators of Atherosclerosis and Calcific Aortic Valve Stenosis.	No abstract available