Protein detail
AGRIN
Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)]
Entry name AGRIN | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 32 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)]
Protein Class (7)
Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters
Protein Function (6)
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Potential drug targets
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
AGRIN
Gene Description
Agrin
Chromosome
1
Position
1020120-1056118
Supporting publications (n)
32
EVMP confidence score
0.88
Function & Pathway
Protein Function (6)
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Potential drug targets
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component (8)
Molecular Function (9)
- GO:0002162 dystroglycan binding
- GO:0005200 structural constituent of cytoskeleton
- GO:0005201 extracellular matrix structural constituent
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0033691 sialic acid binding
- GO:0035374 chondroitin sulfate binding
- GO:0043236 laminin binding
- GO:0043395 heparan sulfate proteoglycan binding
Biological Process (3)
Reactome (35)
- R-hsa-9694614 attachment and entry
- R-hsa-3560783 defective b4galt7 causes eds progeroid type
- R-hsa-3656237 defective ext2 causes exostoses 2
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9918481 dengue virus host interactions
- R-hsa-9839923 dengue virus infection
- R-hsa-3560782 diseases associated with glycosaminoglycan metabolism
- R-hsa-3781865 diseases of glycosylation
- R-hsa-5668914 diseases of metabolism
- R-hsa-9772572 early sars cov 2 infection events
Page 1 of 4
Canonical Pathways (3)
- M3468 Naba ecm regulators
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories (4)
Clinical-translation mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence31
Ligand-Receptor Signaling (26)
26 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | OmniPath | Yes | ||||
| proteoglycan | receptor_regulator | OmniPath | Yes | Yes | |||
| receptor_regulator | receptor_regulator | OmniPath | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | CellPhoneDB | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AGRIN | O00468 | MUSK | O15146 | Yes | Yes | HPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015Reactome_LRdbconnectomeDB2020HINTSignaLink3CellinkerLRdbHPMR_talklr | SignaLink3:18848351HPMR:8653787connectomeDB2020:8653787Cellinker:8653787LRdb:8653787HINT:37252960SignaLink3:23331499CellTalkDB:8653787 | |
| AGRIN | O00468 | LRP4 | O75096 | Yes | Yes | Fantom5_LRdbCellTalkDBiTALKtalklrSIGNORReactome_LRdbconnectomeDB2020HINTCellinkerLRdbRamilowski2015 | SIGNOR:23458718Cellinker:18848351LRdb:18848351HINT:37252960Ramilowski2015:18848351talklr:18848351connectomeDB2020:18848351 | |
| AGRIN | O00468 | ACHB3 | Q05901 | Yes | Yes | SIGNOR | SIGNOR:14502292 |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
2,068
Mass
217,320
Sequence
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPPSSRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGGGSGGLEPLEGSSVATPGPPVERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSVRAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGATSGAIAAGATARATTASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPPAPQQPPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPKSRKVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP
Alternative Products
Event=Alternative splicing; Named isoforms=7; Comment=Many isoforms may exist depending on the occurrence and length of inserts at the x, y or z splice site. Four 'z' isoforms can be produced with inserts of 0, 8, 11 or 19 AA. Isoform 3 and isoform 6 lack any 'z' insert. Isoforms differ in their acetylcholine receptor clustering activity and tissue specificity.; Name=1; Synonyms=Secreted agrin, LN-agrin; IsoId=O00468-1; Sequence=Displayed; Name=2; Synonyms=Transmembrane agrin, TM-agrin; IsoId=O00468-2; Sequence=VSP_045753, VSP_045754; Name=3; Synonyms=Agrin z(0); IsoId=O00468-3; Sequence=VSP_045756; Name=4; Synonyms=Agrin z(+11); IsoId=O00468-4; Sequence=VSP_045757; Name=5; Synonyms=Agrin z(+8); IsoId=O00468-5; Sequence=VSP_045758; Name=6; Synonyms=Agrin y(0)z(0); IsoId=O00468-6; Sequence=VSP_045755, VSP_045756; Name=7; Synonyms=y(0); IsoId=O00468-7; Sequence=VSP_045755
Alternative Sequence
1..104; Missing (in isoform 2); 105..154; NQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVE -> MPXLAVARDTRQPAGASLLVRGFMVPCNACLILLATATLGFAVLLFLNNY (in isoform 2); 1752..1755; Missing (in isoform 6 and isoform 7); 1889..1907; Missing (in isoform 3 and isoform 6); 1889..1896; Missing (in isoform 4); 1897..1907; Missing (in isoform 5)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Compositional Bias
1023..1042; Low complexity; 1050..1065; Low complexity; 1297..1318; Low complexity; 1321..1332; Pro residues
Domain (CC)
The NtA domain, absent in TM-agrin, is required for binding laminin and connecting to basal lamina.; DOMAIN: Both laminin G-like 2 (G2) and laminin G-like 3 (G3) domains are required for alpha-dystroglycan/DAG1 binding. G3 domain is required for C-terminal heparin, heparan sulfate and sialic acid binding (By similarity).
Domain (FT)
31..157; NtA; 191..244; Kazal-like 1; 264..319; Kazal-like 2; 337..391; Kazal-like 3; 408..463; Kazal-like 4; 484..536; Kazal-like 5; 540..601; Kazal-like 6; 607..666; Kazal-like 7; 699..752; Kazal-like 8; 793..846; Laminin EGF-like 1; 847..893; Laminin EGF-like 2; 917..971; Kazal-like 9; 1130..1252; SEA; 1329..1367; EGF-like 1; 1372..1548; Laminin G-like 1; 1549..1586; EGF-like 2; 1588..1625; EGF-like 3; 1635..1822; Laminin G-like 2; 1818..1857; EGF-like 4; 1868..2065; Laminin G-like 3
Region
995..1096; Disordered; 1277..1334; Disordered
Clinical Relevance
Disease Involvement (2)
Congenital myasthenic syndromeDisease variant
Related Diseases
Antibody
Supporting Publications32
| PMID | Title | Related sentences |
|---|---|---|
| 19837982 | Proteomics analysis of A33 immunoaffinity-purified exosomes released from the human colon tumor cell line LIM1215 reveals a tissue-specific protein signature. | A conspicuous finding of this comparative analysis was the presence of host cell-specific (LIM1215 exosome) proteins such as A33, cadherin-17, carcinoembryonic antigen, epithelial cell surface antigen (EpCAM), proliferating cell nuclear antigen, epidermal growth factor receptor, mucin 13, misshapen-like kinase 1, keratin 18, mitogen-activated protein kinase 4, claudins (1, 3, and 7), centrosomal protein 55 kDa, and ephrin-B1 and -B2. Here, we describe an immunoaffinity capture method using the colon epithelial cell-specific A33 antibody to purify colorectal cancer cell (LIM1215)-derived exosomes. |
| 22740476 | Restoration of full-length APC protein in SW480 colon cancer cells induces exosome-mediated secretion of DKK-4. | No related sentences available |
| 23161513 | Proteomic analysis of exosomes from mutant KRAS colon cancer cells identifies intercellular transfer of mutant KRAS. | Exosomes from mutant KRAS cells contain many tumor-promoting proteins, including KRAS, EGFR, SRC family kinases, and integrins. |
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 29045505 | Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients. | Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers. |
| 30379855 | Harmonization of exosome isolation from culture supernatants for optimized proteomics analysis. | No related sentences available |
| 30585730 | Proteomic Characterization of Epithelial-Like Extracellular Vesicles in Advanced Endometrial Cancer. | No related sentences available |
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No related sentences available |
Page 1 of 4Next