Protein detail
AGRIN
Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)]
Protein symbol AGRIN | UniProt ID | EVMP score 0.75 |
Frequency 36 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters |
Basic Information
Protein Names
Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)]
Protein Class
Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters
Protein Function
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Potential drug targets
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
AGRIN
Gene Description
Agrin
Chromosome
1
Position
1020120-1056118
Frequency
36
EVMP Score
0.75
Fluorescence & Localization
Function & Pathway
Protein Function
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Potential drug targets
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component
Molecular Function
- GO:0002162 dystroglycan binding
- GO:0005200 structural constituent of cytoskeleton
- GO:0005201 extracellular matrix structural constituent
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0033691 sialic acid binding
- GO:0035374 chondroitin sulfate binding
- GO:0043236 laminin binding
- GO:0043395 heparan sulfate proteoglycan binding
Biological Process
Reactome
- R-hsa-9694614 attachment and entry
- R-hsa-3560783 defective b4galt7 causes eds progeroid type
- R-hsa-3656237 defective ext2 causes exostoses 2
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9918481 dengue virus host interactions
- R-hsa-9839923 dengue virus infection
- R-hsa-3560782 diseases associated with glycosaminoglycan metabolism
- R-hsa-3781865 diseases of glycosylation
- R-hsa-5668914 diseases of metabolism
- R-hsa-9772572 early sars cov 2 infection events
- R-hsa-3000178 ecm proteoglycans
- R-hsa-1474244 extracellular matrix organization
- R-hsa-9913351 formation of the dystrophin glycoprotein complex dgc
- R-hsa-1630316 glycosaminoglycan metabolism
- R-hsa-1971475 glycosaminoglycan protein linkage region biosynthesis
- R-hsa-1638091 heparan sulfate heparin hs gag metabolism
- R-hsa-2022928 hs gag biosynthesis
- R-hsa-2024096 hs gag degradation
- R-hsa-5663205 infectious disease
- R-hsa-216083 integrin cell surface interactions
- R-hsa-71387 metabolism of carbohydrates and carbohydrate derivatives
- R-hsa-6806667 metabolism of fat soluble vitamins
- R-hsa-196854 metabolism of vitamins and cofactors
- R-hsa-419037 ncam1 interactions
- R-hsa-375165 ncam signaling for neurite out growth
- R-hsa-9675108 nervous system development
- R-hsa-3000171 non integrin membrane ecm interactions
- R-hsa-9820952 respiratory syncytial virus infection pathway
- R-hsa-9820960 respiratory syncytial virus rsv attachment and entry
- R-hsa-9833110 rsv host interactions
- R-hsa-9694516 sars cov 2 infection
- R-hsa-9679506 sars cov infections
- R-hsa-9709957 sensory perception
- R-hsa-9824446 viral infection pathways
- R-hsa-2187338 visual phototransduction
Canonical Pathways
- M3468 Naba ecm regulators
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Clinical-translation mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
26 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | HPA_secretome | No | No | Yes | No | No |
| secreted | secreted | connectomeDB2020 | No | No | Yes | No | No |
| secreted | secreted | OmniPath | No | No | Yes | No | No |
| ecm | ecm | CellChatDB | Yes | No | Yes | No | No |
| ecm | ecm | Cellinker | Yes | No | Yes | No | No |
| glycoprotein | ecm | Matrisome | Yes | No | Yes | No | No |
Page 3 of 3Previous
Regulatory Interaction Network
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AGRIN | O00468 | MUSK | O15146 | Yes | Yes | No | HPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015Reactome_LRdbconnectomeDB2020HINTSignaLink3CellinkerLRdbHPMR_talklr | SignaLink3:18848351HPMR:8653787connectomeDB2020:8653787Cellinker:8653787LRdb:8653787HINT:37252960SignaLink3:23331499CellTalkDB:8653787 |
| AGRIN | O00468 | LRP4 | O75096 | Yes | Yes | No | Fantom5_LRdbCellTalkDBiTALKtalklrSIGNORReactome_LRdbconnectomeDB2020HINTCellinkerLRdbRamilowski2015 | SIGNOR:23458718Cellinker:18848351LRdb:18848351HINT:37252960Ramilowski2015:18848351talklr:18848351connectomeDB2020:18848351 |
| AGRIN | O00468 | ACHB3 | Q05901 | Yes | Yes | No | SIGNOR | SIGNOR:14502292 |
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
2,068
Mass
217,320
Sequence
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPPSSRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGGGSGGLEPLEGSSVATPGPPVERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSVRAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGATSGAIAAGATARATTASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPPAPQQPPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPKSRKVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP
Alternative Products
Event=Alternative splicing; Named isoforms=7; Comment=Many isoforms may exist depending on the occurrence and length of inserts at the x, y or z splice site. Four 'z' isoforms can be produced with inserts of 0, 8, 11 or 19 AA. Isoform 3 and isoform 6 lack any 'z' insert. Isoforms differ in their acetylcholine receptor clustering activity and tissue specificity.; Name=1; Synonyms=Secreted agrin, LN-agrin; IsoId=O00468-1; Sequence=Displayed; Name=2; Synonyms=Transmembrane agrin, TM-agrin; IsoId=O00468-2; Sequence=VSP_045753, VSP_045754; Name=3; Synonyms=Agrin z(0); IsoId=O00468-3; Sequence=VSP_045756; Name=4; Synonyms=Agrin z(+11); IsoId=O00468-4; Sequence=VSP_045757; Name=5; Synonyms=Agrin z(+8); IsoId=O00468-5; Sequence=VSP_045758; Name=6; Synonyms=Agrin y(0)z(0); IsoId=O00468-6; Sequence=VSP_045755, VSP_045756; Name=7; Synonyms=y(0); IsoId=O00468-7; Sequence=VSP_045755
Alternative Sequence
1..104; Missing (in isoform 2); 105..154; NQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVE -> MPXLAVARDTRQPAGASLLVRGFMVPCNACLILLATATLGFAVLLFLNNY (in isoform 2); 1752..1755; Missing (in isoform 6 and isoform 7); 1889..1907; Missing (in isoform 3 and isoform 6); 1889..1896; Missing (in isoform 4); 1897..1907; Missing (in isoform 5)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Compositional Bias
1023..1042; Low complexity; 1050..1065; Low complexity; 1297..1318; Low complexity; 1321..1332; Pro residues
Domain (CC)
The NtA domain, absent in TM-agrin, is required for binding laminin and connecting to basal lamina.; DOMAIN: Both laminin G-like 2 (G2) and laminin G-like 3 (G3) domains are required for alpha-dystroglycan/DAG1 binding. G3 domain is required for C-terminal heparin, heparan sulfate and sialic acid binding (By similarity).
Domain (FT)
31..157; NtA; 191..244; Kazal-like 1; 264..319; Kazal-like 2; 337..391; Kazal-like 3; 408..463; Kazal-like 4; 484..536; Kazal-like 5; 540..601; Kazal-like 6; 607..666; Kazal-like 7; 699..752; Kazal-like 8; 793..846; Laminin EGF-like 1; 847..893; Laminin EGF-like 2; 917..971; Kazal-like 9; 1130..1252; SEA; 1329..1367; EGF-like 1; 1372..1548; Laminin G-like 1; 1549..1586; EGF-like 2; 1588..1625; EGF-like 3; 1635..1822; Laminin G-like 2; 1818..1857; EGF-like 4; 1868..2065; Laminin G-like 3
Region
995..1096; Disordered; 1277..1334; Disordered
Clinical Relevance
Disease Involvement
Congenital myasthenic syndromeDisease variant
Antibody