Protein detail

AGRIN

Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)]

Entry name
AGRIN
UniProt ID
EVMP confidence score
0.75
Supporting publications (n)
36
Transmembrane count
Protein classification
Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information11
Protein Names
Agrin [Cleaved into: Agrin N-terminal 110 kDa subunit; Agrin C-terminal 110 kDa subunit; Agrin C-terminal 90 kDa fragment (C90); Agrin C-terminal 22 kDa fragment (C22)]
Protein Class (7)
Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted secreted proteinsTransporters
Protein Function (6)
  • Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
  • Predicted intracellular proteins
  • Potential drug targets
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Disease related genes
Entrez Gene Symbol
Gene Synonym
AGRIN
Gene Description
Agrin
Chromosome
1
Position
1020120-1056118
Supporting publications (n)
36
EVMP confidence score
0.75
Function & Pathway8
Protein Function (6)
  • Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
  • Predicted intracellular proteins
  • Potential drug targets
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Disease related genes
Canonical Pathways (3)
  • M3468 Naba ecm regulators
  • M5885 Naba matrisome associated
  • M5889 Naba matrisome
Mediation Categories (4)
Clinical-translation mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence31

Ligand-Receptor Signaling (26)

26 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
secretedsecretedHPA_secretomeNoNoYesNoNo
secretedsecretedconnectomeDB2020NoNoYesNoNo
secretedsecretedOmniPathNoNoYesNoNo
ecmecmCellChatDBYesNoYesNoNo
ecmecmCellinkerYesNoYesNoNo
glycoproteinecmMatrisomeYesNoYesNoNo
Page 3 of 3Previous

Regulatory Interaction Network (3)

3 records.

Source Protein SymbolSource UniProt IDTarget Protein SymbolTarget UniProt IDIs DirectedIs StimulationIs InhibitionDatabaseReferences
AGRINO00468MUSKO15146YesYesNoHPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015Reactome_LRdbconnectomeDB2020HINTSignaLink3CellinkerLRdbHPMR_talklrSignaLink3:18848351HPMR:8653787connectomeDB2020:8653787Cellinker:8653787LRdb:8653787HINT:37252960SignaLink3:23331499CellTalkDB:8653787
AGRINO00468LRP4O75096YesYesNoFantom5_LRdbCellTalkDBiTALKtalklrSIGNORReactome_LRdbconnectomeDB2020HINTCellinkerLRdbRamilowski2015SIGNOR:23458718Cellinker:18848351LRdb:18848351HINT:37252960Ramilowski2015:18848351talklr:18848351connectomeDB2020:18848351
AGRINO00468ACHB3Q05901YesYesNoSIGNORSIGNOR:14502292

Protein Complex Composition (1)

1 record.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
AGRNAPPCOPG1FOSO00468P01100P05067Q9Y6781:1:1:1NetworkBlastCompleatCompleat:HC4016

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity CaptureMass spectrometryWestern blottingFlow cytometry437862381392904593055028740098346
Sequence, Structure & Domains10

Sequences

Length
2,068
Mass
217,320
Sequence
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQEAVAPSTHPTSASVTVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPPSSRPRTTASVPRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGGGSGGLEPLEGSSVATPGPPVERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSVRAIVDVHFDPTTAFRAPDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGATSGAIAAGATARATTASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPPAPQQPPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPKSRKVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP
Alternative Products
Event=Alternative splicing; Named isoforms=7; Comment=Many isoforms may exist depending on the occurrence and length of inserts at the x, y or z splice site. Four 'z' isoforms can be produced with inserts of 0, 8, 11 or 19 AA. Isoform 3 and isoform 6 lack any 'z' insert. Isoforms differ in their acetylcholine receptor clustering activity and tissue specificity.; Name=1; Synonyms=Secreted agrin, LN-agrin; IsoId=O00468-1; Sequence=Displayed; Name=2; Synonyms=Transmembrane agrin, TM-agrin; IsoId=O00468-2; Sequence=VSP_045753, VSP_045754; Name=3; Synonyms=Agrin z(0); IsoId=O00468-3; Sequence=VSP_045756; Name=4; Synonyms=Agrin z(+11); IsoId=O00468-4; Sequence=VSP_045757; Name=5; Synonyms=Agrin z(+8); IsoId=O00468-5; Sequence=VSP_045758; Name=6; Synonyms=Agrin y(0)z(0); IsoId=O00468-6; Sequence=VSP_045755, VSP_045756; Name=7; Synonyms=y(0); IsoId=O00468-7; Sequence=VSP_045755
Alternative Sequence
1..104; Missing (in isoform 2); 105..154; NQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVE -> MPXLAVARDTRQPAGASLLVRGFMVPCNACLILLATATLGFAVLLFLNNY (in isoform 2); 1752..1755; Missing (in isoform 6 and isoform 7); 1889..1907; Missing (in isoform 3 and isoform 6); 1889..1896; Missing (in isoform 4); 1897..1907; Missing (in isoform 5)

3D Structural Models

3D Structure
Electron microscopy (1)

Domain & Motif Annotations

Compositional Bias
1023..1042; Low complexity; 1050..1065; Low complexity; 1297..1318; Low complexity; 1321..1332; Pro residues
Domain (CC)
The NtA domain, absent in TM-agrin, is required for binding laminin and connecting to basal lamina.; DOMAIN: Both laminin G-like 2 (G2) and laminin G-like 3 (G3) domains are required for alpha-dystroglycan/DAG1 binding. G3 domain is required for C-terminal heparin, heparan sulfate and sialic acid binding (By similarity).
Domain (FT)
31..157; NtA; 191..244; Kazal-like 1; 264..319; Kazal-like 2; 337..391; Kazal-like 3; 408..463; Kazal-like 4; 484..536; Kazal-like 5; 540..601; Kazal-like 6; 607..666; Kazal-like 7; 699..752; Kazal-like 8; 793..846; Laminin EGF-like 1; 847..893; Laminin EGF-like 2; 917..971; Kazal-like 9; 1130..1252; SEA; 1329..1367; EGF-like 1; 1372..1548; Laminin G-like 1; 1549..1586; EGF-like 2; 1588..1625; EGF-like 3; 1635..1822; Laminin G-like 2; 1818..1857; EGF-like 4; 1868..2065; Laminin G-like 3
Region
995..1096; Disordered; 1277..1334; Disordered
Clinical Relevance2
Disease Involvement (2)
Congenital myasthenic syndromeDisease variant
Antibody
Supporting Publications32
PMIDTitleAbstract
31941606The role of actinin-4 (ACTN4) in exosomes as a potential novel therapeutic target in castration-resistant prostate cancer.No abstract available
32089743Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism.No abstract available
32295833Dysregulation of Exosome Cargo by Mutant Tau Expressed in Human-induced Pluripotent Stem Cell (iPSC) Neurons Revealed by Proteomics Analyses.Notably, mTau exosomes (not control exosomes) contain ANP32A (also known as I1PP2A), an endogenous inhibitor of the PP2A phosphatase which regulates the phosphorylation state of p-Tau.
32795414Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers.Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers.
32944193Extracellular vesicles from human iPSC-derived neural stem cells: miRNA and protein signatures, and anti-inflammatory and neurogenic properties.No abstract available
34571828Proteomic Analysis of Circulating Extracellular Vesicles Identifies Potential Biomarkers for Lymph Node Metastasis in Oral Tongue Squamous Cell Carcinoma.No abstract available
34817906Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform.No abstract available
34980157Proteomic analysis of extracellular vesicles secreted by primary human epithelial endometrial cells reveals key proteins related to embryo implantation.No abstract available
35611462Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients.No abstract available
36612172Extracellular Vesicle Membrane Protein Profiling and Targeted Mass Spectrometry Unveil CD59 and Tetraspanin 9 as Novel Plasma Biomarkers for Detection of Colorectal Cancer.No abstract available
Page 2 of 4PreviousNext