Protein detail
TSN4
Tetraspanin-4 (Tspan-4) (Novel antigen 2) (NAG-2) (Transmembrane 4 superfamily member 7)
Entry name TSN4 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 3 | Transmembrane count 4 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information7
Protein Names
Tetraspanin-4 (Tspan-4) (Novel antigen 2) (NAG-2) (Transmembrane 4 superfamily member 7)
Transmembrane
14..34; Helical; 56..76; Helical; 86..106; Helical; 202..222; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Supporting publications (n)
3
EVMP confidence score
0.25
Fluorescence & Localization1
Cell SpecificEsophageal basal cells
Function & Pathway4
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
Mediation Categories
Adhesion and uptake mediation
Relations & Evidence23
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
Sequence, Structure & Domains5
Sequences
Length
238
Mass
26,118
Sequence
MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 31382537 | An Insight into the Proteome of Uveal Melanoma-Derived Ectosomes Reveals the Presence of Potentially Useful Biomarkers. | No abstract available |
| 35119778 | Optimization of small extracellular vesicle isolation from expressed prostatic secretions in urine for in-depth proteomic analysis. | No abstract available |
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No abstract available |