Protein detail
OBRG
Leptin receptor gene-related protein (Endospanin-1) (Leptin receptor overlapping transcript protein) (OB-R gene-related protein) (OB-RGRP)
Entry name OBRG | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count 4 | Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Leptin receptor gene-related protein (Endospanin-1) (Leptin receptor overlapping transcript protein) (OB-R gene-related protein) (OB-RGRP)
Protein Class (8)
Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteins
Protein Function (6)
- Cancer-related genes:Mutational cancer driver genes
- CD markers
- Candidate cardiovascular disease genes
- Human disease related genes:Endocrine and metabolic diseases:Other endocrine and metabolic diseases
- Disease related genes
- FDA approved drug targets:Biotech drugs
Transmembrane
7..27; Helical; 32..52; Helical; 69..89; Helical; 100..120; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD295OBR
Gene Description
Leptin receptor
Chromosome
1
Position
65420652-65641559
Supporting publications (n)
1
EVMP confidence score
0.38
Function & Pathway7
Protein Function (6)
- Cancer-related genes:Mutational cancer driver genes
- CD markers
- Candidate cardiovascular disease genes
- Human disease related genes:Endocrine and metabolic diseases:Other endocrine and metabolic diseases
- Disease related genes
- FDA approved drug targets:Biotech drugs
Cellular Component (4)
Molecular Function (6)
Biological Process (3)
KEGG (7)
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence93
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| LEPR | JAK2 | O60674 | Y | 986 | phosphorylation | SIGNOR | SIGNOR:11018044 |
| LEPR | JAK2 | O60674 | Y | 1,141 | phosphorylation | SIGNORSparser_ProtMapperProtMapper | SIGNOR:11018044ProtMapper:11970889 |
| LEPR | GSK3B | P49841 | S | 100 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:19923321 |
| LEPR | LEP | P41159 | Y | 1,079 | phosphorylation | Sparser_ProtMapperProtMapper |
Ligand-Receptor Signaling (72)
72 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | No |
| basolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | Yes | Yes | No |
Regulatory Interaction Network (11)
11 records.
Page 1 of 2Next
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| LEPR homodimer complex | LEPR | P48357 | 2 | CORUMPDB | CORUM:1992PDB:3v6o | 9038364 |
| SNX complex (SNX1SNX1aSNX2SNX4LEPR) | LEPRSNX1SNX2SNX4 | O60749O95219P48357Q13596 | 1:1:1:1 | CompleatCORUM | Compleat:HC2400CORUM:1091 | 9819414 |
| JAK2LEPR | O60674P48357 | 2:2 | PDB | PDB:6e2p | ||
| LEPRSNX1SNX2SNX4SNX6UBC | O60749O95219P0CG48P48357Q13596Q9UNH7 | 1:1:1:1:1:1 | CompleatCFinder | Compleat:HC3850 | ||
| BTNL8GLRBLEPROSBP2 | P48167P48357Q6UX41Q969R2 | 0:0:0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 27894104 |
Sequence, Structure & Domains5
Sequences
Length
131
Mass
14,254
Sequence
MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW
Domain & Motif Annotations
Protein Families
OB-RGRP/VPS55 family
Sequence Similarities
Belongs to the OB-RGRP/VPS55 family.
Clinical Relevance6
Disease Involvement (3)
Cancer-related genesFDA approved drug targetsObesity
Related Diseases (5)
Biomarker
Approved; Investigative
Drug Targets
FDA approved drug targets
Drugs (7)
Antibody
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No abstract available |