Protein detail

OBRG

Leptin receptor gene-related protein (Endospanin-1) (Leptin receptor overlapping transcript protein) (OB-R gene-related protein) (OB-RGRP)

Protein symbol OBRG	UniProt ID O15243	EVMP score 0.38
Frequency 1	Transmembrane count 4	Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Leptin receptor gene-related protein (Endospanin-1) (Leptin receptor overlapping transcript protein) (OB-R gene-related protein) (OB-RGRP)

Protein Class

Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteins

Protein Function

Cancer-related genes:Mutational cancer driver genes
CD markers
Candidate cardiovascular disease genes
Human disease related genes:Endocrine and metabolic diseases:Other endocrine and metabolic diseases
Disease related genes
FDA approved drug targets:Biotech drugs

Transmembrane

7..27; Helical; 32..52; Helical; 69..89; Helical; 100..120; Helical

Transmembrane Count

Ensembl

ENSG00000116678

Entrez Gene Symbol

LEPR

Gene Synonym

CD295OBR

Gene Description

Leptin receptor

Chromosome

Position

65420652-65641559

Frequency

EVMP Score

0.38

Fluorescence & Localization

Function & Pathway

Protein Function

Cancer-related genes:Mutational cancer driver genes
CD markers
Candidate cardiovascular disease genes
Human disease related genes:Endocrine and metabolic diseases:Other endocrine and metabolic diseases
Disease related genes
FDA approved drug targets:Biotech drugs

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

R-hsa-2586552 signaling by leptin

Mediation Categories

Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
LEPR	JAK2	O60674	Y	986	phosphorylation	SIGNOR	SIGNOR:11018044
LEPR	JAK2	O60674	Y	1,141	phosphorylation	SIGNORSparser_ProtMapperProtMapper	SIGNOR:11018044 ProtMapper:11970889
LEPR	GSK3B	P49841	S	100	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:19923321
LEPR	LEP	P41159	Y	1,079	phosphorylation	Sparser_ProtMapperProtMapper

Ligand-Receptor Signaling

72 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR	No	No	Yes	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	Yes	Yes	No
secreted	secreted	UniProt_keyword	No	No	Yes	Yes	No
secreted	secreted	UniProt_location	No	No	Yes	Yes	No
secreted	secreted	HPA_secretome	No	No	Yes	Yes	No
secreted	secreted	OmniPath	No	No	Yes	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	Yes	Yes	No
cell_surface	cell_surface	connectomeDB2020	No	No	Yes	Yes	No
cell_surface	cell_surface	OmniPath	No	No	Yes	Yes	No
ligand	ligand	CellPhoneDB	Yes	No	Yes	Yes	No

Page 6 of 8Previous Next

Regulatory Interaction Network

11 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LEPR	P48357	JAK1	P23458	Yes	Yes	No	WangSignaLink3	SignaLink3:16173077 SignaLink3:23331499
JAK2	O60674	LEPR	P48357	Yes	Yes	No	WangSparser_ProtMapperNetPathiPTMnetPhosphoPointSIGNORProtMapperHPRDHINTSIGNOR_ProtMapperREACH_ProtMapperSPIKE_LC	ProtMapper:33637536 ProtMapper:32069871 ProtMapper:33338554 HINT:30044226 SPIKE_LC:17145710 ProtMapper:11970889 ProtMapper:34006608 HPRD:8608603 ProtMapper:11018044 NetPath:9092791 HINT:11585385 SIGNOR:11018044 ProtMapper:32976556 ProtMapper:31167202
LEPR	P48357	JAK2	O60674	Yes	Yes	No	WangKEGG-MEDICUSNetPathSIGNORHPRDHINTSignaLink3CellinkerSPIKE_LCSPIKE	SignaLink3:8608603 SignaLink3:12657512 HINT:30044226 SPIKE_LC:17145710 SIGNOR:18718905 SPIKE:17312100 HPRD:8608603 Cellinker:30044226 NetPath:9092791 HINT:11585385 SignaLink3:23331499 SPIKE_LC:17312100 SignaLink3:21166956
LEPR	P48357	STAT3	P40763	Yes	Yes	No	NetPathSIGNORHPRDSignaLink3Wang	SIGNOR:18718905 NetPath:11445068 HPRD:8608603 SIGNOR:11018044 SignaLink3:21166956
LEP	P41159	LEPR	P48357	Yes	Yes	No	iTALKKirouac2010KEGG-MEDICUSGuide2Pharma_LRdbICELLNETSIGNORHINTSignaLink3DIPHPMR_talklrHPMRCellChatDBHPRD_LRdbDLRP_CellinkertalklrHPRDCui2007Wojtowicz2020Ramilowski2015_Baccin2019DLRP_talklrGuide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrBaccin2019CellinkerSTRING_talklrCellCallCellTalkDBFantom5_LRdbHPMR_CellinkerNetPathconnectomeDB2020LRdb	HINT:22405007LRdb:861HPRD:8608603 Baccin2019:8608603 SIGNOR:9463481 Cellinker:9463481 Baccin2019:9463481 NetPath:12226096 CellTalkDB:9463481 LRdb:9463481 connectomeDB2020:8608603 ICELLNET:9463481 HPMR:9463481 NetPath:9218470 connectomeDB2020:9463481 SignaLink3:23331499 HINT:36959263 Cellinker:8608603 HINT:33961781 DIP:9786864 SignaLink3:9207021 DIP:22405007
LEPR	P48357	TYK2	P29597	Yes	Yes	No	WangSignaLink3	SignaLink3:23331499 SignaLink3:17228025
CISH	Q9NSE2	LEPR	P48357	Yes	Yes	No	NetPathSignaLink3	SignaLink3:23331499 SignaLink3:18708154 NetPath:16684815
SOCS2	O14508	LEPR	P48357	Yes	Yes	Yes	NetPathWangSignaLink3	SignaLink3:23331499 SignaLink3:18708154 NetPath:16684815
SOCS3	O14543	LEPR	P48357	Yes	Yes	Yes	NCI-PID_ProtMapperProtMapperHPRDSignaLink3BioGRIDWang	BioGRID:21239736 ProtMapper:10514492 SignaLink3:11018044 SignaLink3:18708154 BioGRID:11018044 SignaLink3:23331499 SignaLink3:21239736 HPRD:11018044 ProtMapper:8548812
LEPR	P48357	SH2B1	Q9NRF2	Yes	Yes	No	SIGNOR	SIGNOR:27154742

Page 1 of 2Next

Protein Complex Composition

5 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
LEPR homodimer complex	LEPR	P48357	2	CORUMPDB	CORUM:1992PDB:3v6o	9038364
SNX complex (SNX1SNX1aSNX2SNX4LEPR)	LEPR SNX1 SNX2 SNX4	O60749 O95219 P48357 Q13596	1:1:1:1	CompleatCORUM	Compleat:HC2400CORUM:1091	9819414
	JAK2 LEPR	O60674 P48357	2:2	PDB	PDB:6e2p
	LEPR SNX1 SNX2 SNX4 SNX6 UBC	O60749 O95219 P0CG48 P48357 Q13596 Q9UNH7	1:1:1:1:1:1	CompleatCFinder	Compleat:HC3850
	BTNL8 GLRB LEPR OSBP2	P48167 P48357 Q6UX41 Q969R2	0:0:0:0	hu.MAP

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blotting	1	27894104

Sequence, Structure & Domains

Sequences

Length

131

Mass

14,254

Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW

3D Structural Models

Domain & Motif Annotations

Protein Families

OB-RGRP/VPS55 family

Sequence Similarities

Belongs to the OB-RGRP/VPS55 family.

Clinical Relevance

Disease Involvement

Cancer-related genesFDA approved drug targetsObesity

Related Diseases

Acute diabete complication Alzheimer disease Cachexia Obesity Solid tumour/cancer

Biomarker

Approved; Investigative

Drug Targets

FDA approved drug targets

Drugs

ATORVASTATIN CALCIUM TRIHYDRATE SIMVASTATIN SETMELANOTIDE MIBAVADEMAB VALPROIC ACID METRELEPTIN NULL

Antibody

HPA030899