Protein detail

ARPC5

Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC)

Entry name ARPC5	UniProt ID O15511	EVMP confidence score 0.75
Supporting publications (n) 28	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000162704

Entrez Gene Symbol

ARPC5

Gene Synonym (3)

ARC16dJ127C7.3p16-Arc

Gene Description

Actin related protein 2/3 complex subunit 5

Chromosome

Position

183620846-183635783

Supporting publications (n)

EVMP confidence score

0.75

Fluorescence & Localization3

Cell SpecificEsophageal basal cellsSingle-Nuclei Brain Specificleukocyte

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (12)

Page 1 of 2

Molecular Function (3)

Biological Process (3)

KEGG (11)

Page 1 of 2

Reactome (15)

Page 1 of 2

Mediation Categories (5)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence31

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
ARPC5	MAPKAPK2	P49137	S	77	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:18725535 KEA:12829704 ProtMapper:12829704 ProtMapper:22792454 HPRD:20068231 HPRD:12829704 SIGNOR:12829704
ARPC5	MAPKAPK2	P49137	S	80	phosphorylation	MIMPHPRD_MIMPPhosphoSite_MIMP

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
ecm	ecm	MatrixDB	Yes	No	No	No	No
ecm	ecm	GO_Intercell	Yes	No	No	No	No
ecm	ecm	OmniPath	Yes	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
ligand	ligand	CellTalkDB	Yes	No	No	No	No
ligand	ligand	OmniPath	Yes	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MAPK2	P49137	ARPC5	O15511	Yes	Yes	No	WangSparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperREACH_ProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper	ProtMapper:18725535 KEA:12829704 ProtMapper:12829704 ProtMapper:22792454 HPRD:12829704 ProtMapper:20068231 HPRD-phos:20068231 SIGNOR:12829704 PhosphoSite:12829704 HPRD-phos:12829704

Protein Complex Composition (18)

18 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ACTR2 ACTR3B ARPC1A ARPC1B ARPC2 ARPC3 ARPC4 ARPC5 ARPC5L EFHD2 RRM1	O15143 O15144 O15145 O15511 P23921 P59998 P61160 Q92747 Q96C19 Q9BPX5 Q9P1U1	0:0:0:0:0:0:0:0:0:0:0	hu.MAP
ACTR2 ACTR3 ACTR3B ARPC1A ARPC1B ARPC2 ARPC3 ARPC4 ARPC5 ARPC5L HNRNPLL	O15143 O15144 O15145 O15511 P59998 P61158 P61160 Q8WVV9 Q92747 Q9BPX5 Q9P1U1	0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
ACTR2 ACTR3 ARPC1A ARPC1B ARPC2 ARPC3 ARPC4 ARPC5 ARPC5L	O15143 O15144 O15145 O15511 P59998 P61158 P61160 Q92747 Q9BPX5	0:0:0:0:0:0:0:0:0	KEGG-MEDICUSHavugimana2012SPIKEhu.MAP2	Havugimana2012:C_577
ACTR2 ARPC1A ARPC2 ARPC3 ARPC5 COG8 EFHD1 RRAGB RRAGC VCAM1	O15144 O15145 O15511 P19320 P61160 Q5VZM2 Q92747 Q96MW5 Q9BUP0 Q9HB90	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8326
ACTR2 ARPC1A ARPC2 ARPC4 ARPC5 ARPC5L DNAJC1 EIF4E HNRNPLL RPAP1 RRM1 TPPP3	O15144 O15511 P06730 P23921 P59998 P61160 Q8WVV9 Q92747 Q96KC8 Q9BPX5 Q9BW30 Q9BWH6	0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
ACTR2 ACTR3 ARPC2 ARPC4 ARPC5 GRB2 UBC	O15144 O15511 P0CG48 P59998 P61158 P61160 P62993	1:1:1:1:1:1:1	CompleatCFinder	Compleat:HC9433
ARPC1A ARPC4 ARPC5 ARPC5L RPAP1 RRM1	O15511 P23921 P59998 Q92747 Q9BPX5 Q9BWH6	0:0:0:0:0:0	hu.MAP
ARPC5 DIS3 FAM98B FARSB	O15511 Q52LJ0 Q9NSD9 Q9Y2L1	0:0:0:0	hu.MAP

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	37713494

Sequence, Structure & Domains9

Sequences

Length

151

Mass

16,320

Sequence

MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O15511-1; Sequence=Displayed; Name=2; IsoId=O15511-2; Sequence=VSP_024028

Alternative Sequence

48; Q -> HSIT (in isoform 2)

3D Structural Models

3D Structure

Electron microscopy (2)

Domain & Motif Annotations

Region

21..44; Disordered

Protein Families

ARPC5 family

Sequence Similarities

Belongs to the ARPC5 family.

Clinical Relevance5

Disease Involvement

Disease variant

Antibody (2)

HPA022013 HPA031972

Interaction Protein (10)

ENSG00000070831ENSG00000077549ENSG00000111229ENSG00000115091ENSG00000130429ENSG00000133627ENSG00000138071ENSG00000163466ENSG00000241553ENSG00000241685

Interaction Count

Interaction Dataset (5)

biogrid_opencellbiogrid_opencell_bioplexbiogrid_bioplexintact_biogridintact_biogrid_bioplex

Supporting Publications28

PMID	Title	Abstract
26826536	[Cardiovascular risk study in patients with renin-angiotensin system blockade by means of the proteone of circulating extracellular vesicles].	No abstract available
27792649	Macrophage Foam Cell-Derived Extracellular Vesicles Promote Vascular Smooth Muscle Cell Migration and Adhesion.	No abstract available
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available
32230970	Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles.	No abstract available
32560723	T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles.	No abstract available
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
32916986	Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines.	No abstract available
33592500	A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia.	No abstract available
33936570	Quantitative proteomic analysis of extracellular vesicle subgroups isolated by an optimized method combining polymer-based precipitation and size exclusion chromatography.	No abstract available
34064677	Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells.	No abstract available

Page 1 of 3Next