Protein detail
ARPC5
Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC)
Protein symbol ARPC5 | UniProt ID | EVMP score 0.75 |
Frequency 28 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Basic Information
Protein Names
Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC)
Protein Class
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
ARC16dJ127C7.3p16-Arc
Gene Description
Actin related protein 2/3 complex subunit 5
Chromosome
1
Position
183620846-183635783
Frequency
28
EVMP Score
0.75
Fluorescence & Localization
Cell SpecificEsophageal basal cellsSingle-Nuclei Brain Specificleukocyte
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
- GO:0005576 extracellular region
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005885 Arp2/3 protein complex
- GO:0005925 focal adhesion
- GO:0015629 actin cytoskeleton
- GO:0030027 lamellipodium
- GO:0034774 secretory granule lumen
- GO:0035861 site of double-strand break
- GO:0070062 extracellular exosome
- GO:1904813 ficolin-1-rich granule lumen
Molecular Function
Biological Process
KEGG
- hsa04144 Endocytosis
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04530 Tight junction
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa05100 Bacterial invasion of epithelial cells
- KEGG:hsa05130 Pathogenic Escherichia coli infection
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05132 Salmonella infection
- KEGG:hsa05135 Yersinia infection
Reactome
- R-hsa-8856828 clathrin mediated endocytosis
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-2682334 eph ephrin signaling
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-9658195 leishmania infection
- R-hsa-199991 membrane trafficking
- R-hsa-9675108 nervous system development
- R-hsa-6798695 neutrophil degranulation
- R-hsa-9664407 parasite infection
- R-hsa-5663213 rho gtpases activate wasps and waves
- R-hsa-195258 rho gtpase effectors
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-5653656 vesicle mediated transport
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ARPC5 | MAPKAPK2 | P49137 | S | 77 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:18725535KEA:12829704ProtMapper:12829704ProtMapper:22792454HPRD:20068231HPRD:12829704SIGNOR:12829704 |
| ARPC5 | MAPKAPK2 | P49137 | S | 80 | phosphorylation | MIMPHPRD_MIMPPhosphoSite_MIMP |
Ligand-Receptor Signaling
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | GO_Intercell | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| ligand | ligand | CellTalkDB | Yes | No | No | No | No |
| ligand | ligand | OmniPath | Yes | No | No | No | No |
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MAPK2 | P49137 | ARPC5 | O15511 | Yes | Yes | No | WangSparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperREACH_ProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | ProtMapper:18725535KEA:12829704ProtMapper:12829704ProtMapper:22792454HPRD:12829704ProtMapper:20068231HPRD-phos:20068231SIGNOR:12829704PhosphoSite:12829704HPRD-phos:12829704 |
Protein Complex Composition
18 records.
Page 1 of 2Next
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37713494 |
Sequence, Structure & Domains
Sequences
Length
151
Mass
16,320
Sequence
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O15511-1; Sequence=Displayed; Name=2; IsoId=O15511-2; Sequence=VSP_024028
Alternative Sequence
48; Q -> HSIT (in isoform 2)
3D Structural Models
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Region
21..44; Disordered
Protein Families
ARPC5 family
Sequence Similarities
Belongs to the ARPC5 family.
Clinical Relevance
Disease Involvement
Disease variant
Interaction Protein
ENSG00000070831ENSG00000077549ENSG00000111229ENSG00000115091ENSG00000130429ENSG00000133627ENSG00000138071ENSG00000163466ENSG00000241553ENSG00000241685
Interaction Count
10
Interaction Dataset
biogrid_opencellbiogrid_opencell_bioplexbiogrid_bioplexintact_biogridintact_biogrid_bioplex