Protein detail

ARPC5

Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC)

Entry name ARPC5	UniProt ID O15511	EVMP confidence score 0.75
Supporting publications (n) 28	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000162704

Entrez Gene Symbol

ARPC5

Gene Synonym (3)

ARC16dJ127C7.3p16-Arc

Gene Description

Actin related protein 2/3 complex subunit 5

Chromosome

Position

183620846-183635783

Supporting publications (n)

EVMP confidence score

0.75

Fluorescence & Localization3

Cell SpecificEsophageal basal cellsSingle-Nuclei Brain Specificleukocyte

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (12)

Page 1 of 2

Molecular Function (3)

Biological Process (3)

KEGG (11)

Page 1 of 2

Reactome (15)

Page 1 of 2

Mediation Categories (5)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence31

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
ARPC5	MAPKAPK2	P49137	S	77	phosphorylation	Sparser_ProtMapperSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:18725535 KEA:12829704 ProtMapper:12829704 ProtMapper:22792454 HPRD:20068231 HPRD:12829704 SIGNOR:12829704
ARPC5	MAPKAPK2	P49137	S	80	phosphorylation	MIMPHPRD_MIMPPhosphoSite_MIMP

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
ecm	ecm	MatrixDB	Yes	No	No	No	No
ecm	ecm	GO_Intercell	Yes	No	No	No	No
ecm	ecm	OmniPath	Yes	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
ligand	ligand	CellTalkDB	Yes	No	No	No	No
ligand	ligand	OmniPath	Yes	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MAPK2	P49137	ARPC5	O15511	Yes	Yes	No	WangSparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperREACH_ProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper	ProtMapper:18725535 KEA:12829704 ProtMapper:12829704 ProtMapper:22792454 HPRD:12829704 ProtMapper:20068231 HPRD-phos:20068231 SIGNOR:12829704 PhosphoSite:12829704 HPRD-phos:12829704

Protein Complex Composition (18)

18 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
ARP2/3	ACTR2 ACTR3 ARPC1A ARPC2 ARPC3 ARPC4 ARPC5	O15144 O15145 O15511 P59998 P61158 P61160 Q92747	1:1:1:1:1:1:1	SIGNORComplexPortalPDB	PDB:6yw7SIGNOR:SIGNOR-C146	26655834 32661131 14755292
Actin-related protein 2/3 complexARPC1A-ACTR3-ARPC5L variant	ACTR2 ACTR3 ARPC1A ARPC2 ARPC3 ARPC4 ARPC5L	O15144 O15145 P59998 P61158 P61160 Q92747 Q9BPX5	1:1:1:1:1:1:1	ComplexPortal		26655834 32661131 14755292
Actin-related protein 2/3 complexARPC1A-ACTR3B-ARPC5 variant	ACTR2 ACTR3B ARPC1A ARPC2 ARPC3 ARPC4 ARPC5	O15144 O15145 O15511 P59998 P61160 Q92747 Q9P1U1	1:1:1:1:1:1:1	ComplexPortal		26655834 32661131 14755292
Actin-related protein 2/3 complexARPC1B-ACTR3-ARPC5L variant	ACTR2 ACTR3 ARPC1B ARPC2 ARPC3 ARPC4 ARPC5L	O15143 O15144 O15145 P59998 P61158 P61160 Q9BPX5	1:1:1:1:1:1:1	ComplexPortalPDB	intact:EBI-9022767PDB:6yw6PDB:6YW6	26655834 32661131 14755292
Actin-related protein 2/3 complexARPC1B-ACTR3B-ARPC5 variant	ACTR2 ACTR3B ARPC1B ARPC2 ARPC3 ARPC4 ARPC5	O15143 O15144 O15145 O15511 P59998 P61160 Q9P1U1	1:1:1:1:1:1:1	ComplexPortal		26655834 32661131 14755292
Actin-related protein 2/3 complexARPC1B-ACTR3B-ARPC5L variant	ACTR2 ACTR3B ARPC1B ARPC2 ARPC3 ARPC4 ARPC5L	O15143 O15144 O15145 P59998 P61160 Q9BPX5 Q9P1U1	1:1:1:1:1:1:1	ComplexPortal		26655834 32661131 14755292
Actin-related protein 2/3 complexARPC1B-ACTR3B-ARPC5L variant	ACTR2 ACTR3B ARPC1A ARPC2 ARPC3 ARPC4 ARPC5L	O15144 O15145 P59998 P61160 Q92747 Q9BPX5 Q9P1U1	1:1:1:1:1:1:1	ComplexPortal		26655834 32661131 14755292
Arp2/3 protein complex	ACTR2 ACTR3 ARPC1B ARPC2 ARPC3 ARPC4 ARPC5	O15143 O15144 O15145 O15511 P59998 P61158 P61160	1:1:1:1:1:1:1	CORUMCompleatComplexPortal	Compleat:HC1939CORUM:27	26655834 32661131 14755292 9359840
Arp2/3 protein complex	ACTR2 ACTR3 ACTR3B ACTR3C ARPC1A ARPC1B ARPC2 ARPC3 ARPC4 ARPC5 ARPC5L	O15143 O15144 O15145 O15511 P59998 P61158 P61160 Q92747 Q9BPX5 Q9C0K3 Q9P1U1	1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC2675	10377407
	ACTL8 ACTR2 ACTR3 ACTR3B ARPC1A ARPC1B ARPC2 ARPC3 ARPC4 ARPC5 RRM1 RRM2 RRM2B UBC	O15143 O15144 O15145 O15511 P0CG48 P23921 P31350 P59998 P61158 P61160 Q7LG56 Q92747 Q9H568 Q9P1U1	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8882

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	37713494

Sequence, Structure & Domains9

Sequences

Length

151

Mass

16,320

Sequence

MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O15511-1; Sequence=Displayed; Name=2; IsoId=O15511-2; Sequence=VSP_024028

Alternative Sequence

48; Q -> HSIT (in isoform 2)

3D Structural Models

3D Structure

Electron microscopy (2)

Domain & Motif Annotations

Region

21..44; Disordered

Protein Families

ARPC5 family

Sequence Similarities

Belongs to the ARPC5 family.

Clinical Relevance5

Disease Involvement

Disease variant

Antibody (2)

HPA022013 HPA031972

Interaction Protein (10)

ENSG00000070831ENSG00000077549ENSG00000111229ENSG00000115091ENSG00000130429ENSG00000133627ENSG00000138071ENSG00000163466ENSG00000241553ENSG00000241685

Interaction Count

Interaction Dataset (5)

biogrid_opencellbiogrid_opencell_bioplexbiogrid_bioplexintact_biogridintact_biogrid_bioplex

Supporting Publications28

PMID	Title	Abstract
34576246	Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators.	No abstract available
36064647	Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells.	No abstract available
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available
36497184	Oxidative Stress and Extracellular Matrix Remodeling Are Signature Pathways of Extracellular Vesicles Released upon Morphine Exposure on Human Brain Microvascular Endothelial Cells.	No abstract available
36982312	Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis.	No abstract available
37204515	Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
37438638	Extracellular Vesicles Play a Central Role in Cerebral Venous Disease-Associated Brain Atrophy.	No abstract available
37926756	Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available

Page 2 of 3Previous Next