Protein detail
ARPC5
Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC)
Entry name ARPC5 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 28 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Actin-related protein 2/3 complex subunit 5 (Arp2/3 complex 16 kDa subunit) (p16-ARC)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ARC16dJ127C7.3p16-Arc
Gene Description
Actin related protein 2/3 complex subunit 5
Chromosome
1
Position
183620846-183635783
Supporting publications (n)
28
EVMP confidence score
0.88
Fluorescence & Localization
Cell SpecificEsophageal basal cellsSingle-Nuclei Brain Specificleukocyte
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (12)
- GO:0005576 extracellular region
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005885 Arp2/3 protein complex
- GO:0005925 focal adhesion
- GO:0015629 actin cytoskeleton
- GO:0030027 lamellipodium
- GO:0034774 secretory granule lumen
- GO:0035861 site of double-strand break
Page 1 of 2
Molecular Function (3)
Biological Process (3)
KEGG (11)
- hsa04144 Endocytosis
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04530 Tight junction
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa05100 Bacterial invasion of epithelial cells
- KEGG:hsa05130 Pathogenic Escherichia coli infection
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05132 Salmonella infection
Page 1 of 2
Reactome (15)
- R-hsa-8856828 clathrin mediated endocytosis
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-2682334 eph ephrin signaling
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-9658195 leishmania infection
- R-hsa-199991 membrane trafficking
- R-hsa-9675108 nervous system development
- R-hsa-6798695 neutrophil degranulation
Page 1 of 2
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence31
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ARPC5 | MAPKAPK2 | P49137 | S | 77 | phosphorylation | Sparser_ProtMapperSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:18725535KEA:12829704ProtMapper:12829704ProtMapper:22792454HPRD:20068231HPRD:12829704SIGNOR:12829704 |
| ARPC5 | MAPKAPK2 | P49137 | S | 80 | phosphorylation | MIMPHPRD_MIMPPhosphoSite_MIMP |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | ||||
| ecm | ecm | GO_Intercell | Yes | ||||
| ecm | ecm | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| ligand | ligand | CellTalkDB | Yes | ||||
| ligand | ligand | OmniPath | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MAPK2 | P49137 | ARPC5 | O15511 | Yes | Yes | WangSparser_ProtMapperPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperREACH_ProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | ProtMapper:18725535KEA:12829704ProtMapper:12829704ProtMapper:22792454HPRD:12829704ProtMapper:20068231HPRD-phos:20068231SIGNOR:12829704PhosphoSite:12829704HPRD-phos:12829704 |
Protein Complex Composition (18)
18 records.
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37713494 |
Sequence, Structure & Domains
Sequences
Length
151
Mass
16,320
Sequence
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O15511-1; Sequence=Displayed; Name=2; IsoId=O15511-2; Sequence=VSP_024028
Alternative Sequence
48; Q -> HSIT (in isoform 2)
3D Structural Models
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Region
21..44; Disordered
Protein Families
ARPC5 family
Sequence Similarities
Belongs to the ARPC5 family.
Clinical Relevance
Disease Involvement
Disease variant
Interaction Protein (10)
ENSG00000070831ENSG00000077549ENSG00000111229ENSG00000115091ENSG00000130429ENSG00000133627ENSG00000138071ENSG00000163466ENSG00000241553ENSG00000241685
Interaction Count
10
Interaction Dataset (5)
biogrid_opencellbiogrid_opencell_bioplexbiogrid_bioplexintact_biogridintact_biogrid_bioplex
Supporting Publications28
| PMID | Title | Related sentences |
|---|---|---|
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 39001700 | Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles. | No related sentences available |
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 40465195 | Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome. | No related sentences available |
| 40840701 | Multiomics analysis to evaluate the enrichment of extracellular vesicles from human plasma. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No related sentences available |
Page 3 of 3Previous