Protein detail
TPSN
Tapasin (TPN) (TPSN) (NGS-17) (TAP-associated protein) (TAP-binding protein)
Entry name TPSN | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 8 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Tapasin (TPN) (TPSN) (NGS-17) (TAP-associated protein) (TAP-binding protein)
Protein Class (7)
Disease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Transmembrane
415..435; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
TAPA
Gene Description
TAP binding protein
Chromosome
6
Position
33299694-33314284
Supporting publications (n)
8
EVMP confidence score
0.63
Fluorescence & Localization1
Cell SpecificDecidual stromal cells
Function & Pathway7
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component (8)
- GO:0000139 Golgi membrane
- GO:0005783 endoplasmic reticulum
- GO:0005789 endoplasmic reticulum membrane
- GO:0030670 phagocytic vesicle membrane
- GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
- GO:0042824 MHC class I peptide loading complex
- GO:0061779 Tapasin-ERp57 complex
- GO:0098553 lumenal side of endoplasmic reticulum membrane
Molecular Function (10)
- GO:0005515 protein binding
- GO:0023024 MHC class I protein complex binding
- GO:0042288 MHC class I protein binding
- GO:0042605 peptide antigen binding
- GO:0044183 protein folding chaperone
- GO:0046978 TAP1 binding
- GO:0046979 TAP2 binding
- GO:0051082 unfolded protein binding
- GO:0060090 molecular adaptor activity
- GO:0062061 TAP complex binding
Biological Process (3)
KEGG (5)
Reactome (4)
Mediation Categories (3)
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence21
Ligand-Receptor Signaling (17)
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
Page 1 of 2Next
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| TAP complex | ABCB9TAP1TAP2TAPBP | O15533Q03518Q03519Q9NP78 | 1:1:1:1 | Compleat | Compleat:HC739 | 179476441551857611133832 |
| Tapasin-ERp57 complex | PDIA3TAPBP | O15533P30101 | 2:2 | ComplexPortalPDB | intact:EBI-9013963PDB:3f8u | 186882351475529214732712 |
| TAPBP | O15533 | 2 | PDB | PDB:7tuf |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [MALDI TOF]Mass spectrometry|Western blottingWestern blottingMass spectrometry [LTQ-FT Ultra]|Western blottingMass spectrometry [QTOF]R Sequencing | 8 | 3064052433497388335016903408017234507095351829873618709736187097 |
Sequence, Structure & Domains11
Sequences
Length
448
Mass
47,571
Sequence
MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPTVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O15533-1; Sequence=Displayed; Name=2; IsoId=O15533-2; Sequence=VSP_002577; Name=3; IsoId=O15533-3; Sequence=VSP_017055; Name=4; Synonyms=tpsnDeltaEx3; IsoId=O15533-4; Sequence=VSP_044455
Alternative Sequence
70..156; Missing (in isoform 4); 405..448; LSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE -> KSWELCGI (in isoform 2); 446..448; KAE -> VQCSTSLYLSLVTLSPHPISKPMEGGCWCGRQNLGLEFTLIWVKTWHYILTVGLFEHAT (in isoform 3)
3D Structural Models
Turn
34..36; 306..308
Helix
62..64; 74..81; 104..109; 117..119; 188..191; 263..265; 373..375
Beta Strand
23..29; 41..46; 50..52; 58..60; 65..69; 90..96; 112..116; 123..129; 134..141; 148..150; 153..164; 169..171; 176..178; 181..184; 203..210; 213..220; 236..242; 246..248; 250..258; 267..275; 278..290; 293..300; 302..304; 313..323; 327..337; 345..349; 360..367; 379..385; 394..399
3D Structure
Electron microscopy (2); X-ray crystallography (5)
Domain & Motif Annotations
Domain (CC)
The N-terminus is required for efficient association with MHC class I molecule and for a stable interaction between MHC I and calreticulin. Binding to TAP is mediated by the C-terminal region.
Domain (FT)
292..399; Ig-like C1-type
Clinical Relevance5
Supporting Publications8
| PMID | Title | Abstract |
|---|---|---|
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No abstract available |
| 31588238 | Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment. | No abstract available |
| 36982312 | Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 39505756 | Differential proteomic profiles of exosomes in pediatric and adult adamantinomatous craniopharyngioma cyst fluid. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |
| 40784529 | Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine. | No abstract available |