Protein detail
ASAP2
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (Development and differentiation-enhancing factor 2) (Paxillin-associated protein with ARF GAP activity 3) (PAG3) (Pyk2 C-terminus-associated protein) (PAP)
Entry name ASAP2 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 12 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (Development and differentiation-enhancing factor 2) (Paxillin-associated protein with ARF GAP activity 3) (PAG3) (Pyk2 C-terminus-associated protein) (PAP)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CENTB3DDEF2KIAA0400PAPSHAG1
Gene Description
ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
Chromosome
2
Position
9206765-9405683
Supporting publications (n)
12
EVMP confidence score
0.72
Fluorescence & Localization
Tissue SpecificintestineCell SpecificAstrocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence18
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ASAP2 | SIK1 | P57059 | S | 701 | phosphorylation | PhosphoNetworks | |
| ASAP2 | PRKACA | P17612 | S | 822 | phosphorylation | PhosphoNetworks | |
| ASAP2 | RPS6KB1 | P23443 | S | 822 | phosphorylation | PhosphoNetworks | |
| ASAP2 | SRPK2 | P78362 | S | 822 | phosphorylation | PhosphoNetworks |
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ASAP2 | O43150 | ARF5 | P84085 | Yes | Yes | HPRDSIGNOR | SIGNOR:10022920HPRD:10749932HPRD:10022920 | |
| ASAP2 | O43150 | ARF1 | P84077 | Yes | Yes | Yes | HPRDWangSIGNORAdhesome | HPRD:10749932Adhesome:11304556Adhesome:10022920SIGNOR:10022920HPRD:10022920Adhesome:10749932 |
| FAK2 | Q14289 | ASAP2 | O43150 | Yes | Yes | AdhesomePhosphoPointSIGNORHPRDWang | SIGNOR:10022920HPRD:10022920Adhesome:10022920 | |
| ASAP2 | O43150 | ARF6 | P62330 | Yes | Yes | HPRDWangSIGNOR | SIGNOR:10022920HPRD:10749932HPRD:10022920 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 31718609 |
Sequence, Structure & Domains
Sequences
Length
1,006
Mass
111,651
Sequence
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKAINSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQGNKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKHADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPSTTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTNPLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKSTPLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=PAPalpha; IsoId=O43150-1; Sequence=Displayed; Name=2; Synonyms=PAPbeta; IsoId=O43150-2; Sequence=VSP_009722
Alternative Sequence
795..840; VQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN -> D (in isoform 2)
Domain & Motif Annotations
Compositional Bias
288..300; Polar residues; 794..823; Polar residues; 865..886; Pro residues
Repeat
584..616; ANK 1; 620..649; ANK 2
Coiled Coil
256..283; 729..752
Domain (CC)
The conserved Arg-464 in the Arf-GAP domain probably becomes part of the active site of bound small GTPases and is necessary for GTP hydrolysis.
Domain (FT)
305..397; PH; 421..543; Arf-GAP; 944..1006; SH3
Region
288..312; Disordered; 701..720; Disordered; 764..916; Disordered
Clinical Relevance
Supporting Publications12
| PMID | Title | Related sentences |
|---|---|---|
| 27605433 | Secreted primary human malignant mesothelioma exosome signature reflects oncogenic cargo. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 29148239 | Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants. | No related sentences available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No related sentences available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No related sentences available |
| 39940641 | Disease-Associated Signatures Persist in Extracellular Vesicles from Reprogrammed Cells of Osteoarthritis Patients. | No related sentences available |
Page 1 of 2Next