Protein detail

ASAP2

Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (Development and differentiation-enhancing factor 2) (Paxillin-associated protein with ARF GAP activity 3) (PAG3) (Pyk2 C-terminus-associated protein) (PAP)

Entry name ASAP2	UniProt ID O43150	EVMP confidence score 0.60
Supporting publications (n) 12	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000151693

Entrez Gene Symbol

ASAP2

Gene Synonym (5)

CENTB3DDEF2KIAA0400PAPSHAG1

Gene Description

ArfGAP with SH3 domain, ankyrin repeat and PH domain 2

Chromosome

Position

9206765-9405683

Supporting publications (n)

EVMP confidence score

0.60

Fluorescence & Localization3

Tissue SpecificintestineCell SpecificAstrocytes

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (3)

Molecular Function (3)

Biological Process (3)

KEGG (2)

Mediation Categories

Receptor-signaling mediation

Relations & Evidence18

Enzyme-Mediated Modification (4)

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database
ASAP2	SIK1	P57059	S	701	phosphorylation	PhosphoNetworks
ASAP2	PRKACA	P17612	S	822	phosphorylation	PhosphoNetworks
ASAP2	RPS6KB1	P23443	S	822	phosphorylation	PhosphoNetworks
ASAP2	SRPK2	P78362	S	822	phosphorylation	PhosphoNetworks

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network (4)

4 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ASAP2	O43150	ARF5	P84085	Yes	Yes	No	HPRDSIGNOR	SIGNOR:10022920 HPRD:10749932 HPRD:10022920
ASAP2	O43150	ARF1	P84077	Yes	Yes	Yes	HPRDWangSIGNORAdhesome	HPRD:10749932 Adhesome:11304556 Adhesome:10022920 SIGNOR:10022920 HPRD:10022920 Adhesome:10749932
FAK2	Q14289	ASAP2	O43150	Yes	Yes	No	AdhesomePhosphoPointSIGNORHPRDWang	SIGNOR:10022920 HPRD:10022920 Adhesome:10022920
ASAP2	O43150	ARF6	P62330	Yes	Yes	No	HPRDWangSIGNOR	SIGNOR:10022920 HPRD:10749932 HPRD:10022920

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ASAP2 DOK1 NCK2 WIPF3	A6NGB9 O43150 O43639 Q99704	0:0:0:0	hu.MAP
	ASAP2 CBLB SH3KBP1	O43150 Q13191 Q96B97	1:1:1	CompleatCFinder	Compleat:HC3660

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	31718609

Sequence, Structure & Domains11

Sequences

Length

1,006

Mass

111,651

Sequence

MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKAINSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMNNIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQGNKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKHADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPSTTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTNPLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKSTPLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=PAPalpha; IsoId=O43150-1; Sequence=Displayed; Name=2; Synonyms=PAPbeta; IsoId=O43150-2; Sequence=VSP_009722

Alternative Sequence

795..840; VQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN -> D (in isoform 2)

Domain & Motif Annotations

Compositional Bias

288..300; Polar residues; 794..823; Polar residues; 865..886; Pro residues

Repeat

584..616; ANK 1; 620..649; ANK 2

Coiled Coil

256..283; 729..752

Domain (CC)

The conserved Arg-464 in the Arf-GAP domain probably becomes part of the active site of bound small GTPases and is necessary for GTP hydrolysis.

Domain (FT)

305..397; PH; 421..543; Arf-GAP; 944..1006; SH3

Region

288..312; Disordered; 701..720; Disordered; 764..916; Disordered

Clinical Relevance4

Antibody (2)

CAB018615 HPA068383

Interaction Protein (2)

ENSG00000147010ENSG00000177885

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications12

PMID	Title	Abstract
40089067	Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells.	No abstract available
40748658	Exosomes released from senescent cells and circulatory exosomes isolated from human plasma reveal aging-associated proteomic and lipid signatures.	No abstract available

Page 2 of 2Previous