Protein detail
ADA12
Disintegrin and metalloproteinase domain-containing protein 12 (ADAM 12) (EC 3.4.24.-) (Meltrin-alpha)
Entry name ADA12 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted membrane proteinsPredicted secreted proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Disintegrin and metalloproteinase domain-containing protein 12 (ADAM 12) (EC 3.4.24.-) (Meltrin-alpha)
Protein Class (3)
Predicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function (2)
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
Transmembrane
709..729; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
MCMPMltnaMLTN
Gene Description
ADAM metallopeptidase domain 12
Chromosome
10
Position
126012381-126388477
Supporting publications (n)
1
EVMP confidence score
0.50
Function & Pathway6
Protein Function (2)
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
Cellular Component (3)
Molecular Function (5)
Biological Process (3)
Reactome (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence40
Ligand-Receptor Signaling (38)
38 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | Yes | No |
| secreted | secreted | UniProt_location | No | No | Yes | Yes | No |
| secreted | secreted | HPA_secretome | No | No | Yes | Yes | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ADA12 | O43184 | SDC4 | P31431 | Yes | Yes | No | Fantom5_LRdbCellTalkDBHPMR_LRdbiTALKAdhesometalklrRamilowski2015SIGNORconnectomeDB2020WangLRdbSTRING_talklrEMBRACEHPMR_talklr | Adhesome:12509413connectomeDB2020:12509413CellTalkDB:12509413SIGNOR:12509413LRdb:12509413 |
Sequence, Structure & Domains10
Sequences
Length
909
Mass
99,542
Sequence
MAARPLPVSPARALLLALAGALLAPCEARGVSLWNQGRADEVVSASVGSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGTACRDSSNSCDLPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVSIETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHECAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLNGLNVPQPQSTQRVLPPLHRAPRAPSVPARPLPAKPALRQAQGTCKPNPPQKPLPADPLARTTRLTHALARTPGQWETGLRLAPLRPAPQYPHQVPRSTHTAYIK
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=12L; IsoId=O43184-1; Sequence=Displayed; Name=2; Synonyms=12S; IsoId=O43184-2; Sequence=VSP_005476, VSP_005477; Name=3; IsoId=O43184-3; Sequence=VSP_031001, VSP_005476, VSP_005477; Name=4; IsoId=O43184-4; Sequence=VSP_031001, VSP_031002, VSP_031003
Alternative Sequence
114..116; Missing (in isoform 3 and isoform 4); 705..740; DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLLFT -> GKEARQEAAESNRERGQGQEPVGSQEHASTASLTLI (in isoform 4); 705..738; DNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLL -> EARQEAAESNRERGQGQEPVGSQEHASTASLTLI (in isoform 2 and isoform 3); 739..909; Missing (in isoform 2 and isoform 3); 741..909; Missing (in isoform 4)
Domain & Motif Annotations
Compositional Bias
851..860; Pro residues
Motif
177..184; Cysteine switch; 828..834; SH3-binding; class II; 834..841; SH3-binding; class I; 885..891; SH3-binding; class I
Domain (CC)
The cysteine-rich domain supports cell adhesion through syndecans and triggers signaling events that lead to beta-1 integrin-dependent cell spreading. In carcinomas cells the binding of this domain to syndecans does not allow the integrin-mediated cell spreading.; DOMAIN: The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
Domain (FT)
214..416; Peptidase M12B; 424..510; Disintegrin; 656..688; EGF-like
Region
822..862; Disordered
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No abstract available |