Protein detail

PPIP1

Proline-serine-threonine phosphatase-interacting protein 1 (PEST phosphatase-interacting protein 1) (CD2-binding protein 1) (H-PIP)

Entry name PPIP1	UniProt ID O43586	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Proline-serine-threonine phosphatase-interacting protein 1 (PEST phosphatase-interacting protein 1) (CD2-binding protein 1) (H-PIP)

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Disease related genes
Human disease related genes:Immune system diseases:Other immune system diseases
Predicted intracellular proteins

Ensembl

ENSG00000140368

Entrez Gene Symbol

PSTPIP1

Gene Synonym (6)

CD2BP1CD2BP1LCD2BP1SH-PIPPAPASPSTPIP

Gene Description

Proline-serine-threonine phosphatase interacting protein 1

Chromosome

Position

76993359-77037475

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization4

Tissue Specificlymphoid tissueCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificclassical monocyte

Function & Pathway7

Protein Function (3)

Disease related genes
Human disease related genes:Immune system diseases:Other immune system diseases
Predicted intracellular proteins

Cellular Component (9)

Molecular Function (3)

Biological Process (3)

KEGG

hsa04621 NOD-like receptor signaling pathway

Reactome (7)

Mediation Categories (3)

Clinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence30

Enzyme-Mediated Modification (4)

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PSTPIP1	ABL1	P00519	Y	345	phosphorylation	phosphoELM_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapper	phosphoELM:11163214 ProtMapper:11163214 HPRD:11163214 KEA:11163214 SIGNOR:11163214
PSTPIP1	PTPN12	Q05209	Y	345	dephosphorylation	HPRDSIGNOR	HPRD:11711533 SIGNOR:11711533 HPRD:11971877
PSTPIP1	PTPN12	Q05209	Y	345	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:11711533
PSTPIP1	LCK	P06239	Y	345	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
fbar_actin_dynamics_endocytosis	intracellular_intercellular_related	HGNC	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network (5)

5 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PPIP1	O43586	ABL1	P00519	Yes	Yes	Yes	SIGNORHPRDSignaLink3SPIKE_LCLit-BM-17SPIKE	SPIKE_LC:11163214 SPIKE:11163214 SPIKE_LC:20841568 SignaLink3:11163214 HPRD:11163214 SignaLink3:23331499 SIGNOR:11163214 Lit-BM-17:11163214 SPIKE:20841568
ABL1	P00519	PPIP1	O43586	Yes	Yes	No	SPIKEphosphoELM_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEAphosphoELMSIGNOR_ProtMapperLit-BM-17HPRD-phosSPIKE_LC	SPIKE_LC:11163214 SPIKE:11163214 SPIKE_LC:20841568 phosphoELM:11163214 ProtMapper:11163214 HPRD:11163214 KEA:11163214 SIGNOR:11163214 Lit-BM-17:11163214 SPIKE:20841568 HPRD-phos:11163214
PTN12	Q05209	PPIP1	O43586	Yes	No	Yes	SPIKEWangNetPathSIGNORProtMapperDEPODHPRDHINTHuRIIntActSIGNOR_ProtMapperHPRD-phosSPIKE_LC	IntAct:32296183 SPIKE_LC:14707117 HPRD:11711533 HINT:35152348 HPRD-phos:11711533 HINT:9422760 IntAct:35152348 HPRD:9422760 SIGNOR:11711533 HPRD:11971877 SPIKE:14707117 DEPOD:11711533 NetPath:14707117 HINT:14707117 HINT:11711533 HINT:11971877 IntAct:14707117 HPRD-phos:11971877 IntAct:11971877 ProtMapper:11711533
PPIP1	O43586	DYN2	P50570	Yes	No	Yes	SIGNOR	SIGNOR:18480402
PPIP1	O43586	PTN18	Q99952	Yes	Yes	No	SIGNORHPRDHINTIntActLit-BM-17	Lit-BM-17:9422760 HINT:35152348 IntAct:35152348 HPRD:9422760 Lit-BM-17:9265651 IntAct:9422760 HPRD:9265651 HPRD:11971877 HINT:9265651 SIGNOR:9422760 HINT:9422760

Protein Complex Composition (11)

11 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	PSTPIP1 PTPN22	O43586 Q9Y2R2	2:1	PDB	PDB:7aam

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyPolymer Precipitation	Mass spectrometry	5	28986585 27894104 30646616 30950185 34980157

Sequence, Structure & Domains12

Sequences

Length

416

Mass

47,591

Sequence

MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKARQCKDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSMQCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPGIQPSCGMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=CD2BP1L; IsoId=O43586-1; Sequence=Displayed; Name=2; Synonyms=CD2BP1S; IsoId=O43586-2; Sequence=VSP_015627

Alternative Sequence

280..309; APVPYQNYYDREVTPLTSSPGIQPSCGMIK -> GEVRLADSAAS (in isoform 2)

3D Structural Models

Turn

162..164

Helix

7..10; 20..63; 71..161; 167..257; 261..272; 410..412

Beta Strand

275..277; 363..365; 373..377; 385..390; 393..401; 404..409

3D Structure

NMR spectroscopy (1); X-ray crystallography (3)

Domain & Motif Annotations

Coiled Coil

166..212

Domain (CC)

The F-BAR domain is important for filament formation. The SH3 domain is not required for filament formation or localization to the uropod.

Domain (FT)

5..264; F-BAR; 359..416; SH3

Clinical Relevance5

Disease Involvement

Disease variant

Antibody (3)

HPA010116 HPA010600 HPA072744

Interaction Protein (4)

ENSG00000015285ENSG00000072135ENSG00000116824ENSG00000127947

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available