Protein detail
SIGL6
Sialic acid-binding Ig-like lectin 6 (Siglec-6) (CD33 antigen-like 1) (CDw327) (Obesity-binding protein 1) (OB-BP1) (CD antigen CD327)
Entry name SIGL6 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sialic acid-binding Ig-like lectin 6 (Siglec-6) (CD33 antigen-like 1) (CDw327) (Obesity-binding protein 1) (OB-BP1) (CD antigen CD327)
Protein Class (3)
CD markersPredicted membrane proteinsPredicted secreted proteins
Protein Function (2)
- Predicted secreted proteins
- CD markers
Transmembrane
348..368; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CD327CD33LCD33L1OB-BP1SIGLEC-6
Gene Description
Sialic acid binding Ig like lectin 6
Chromosome
19
Position
51517819-51531856
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specifichippocampal CA4Blood Cell Specificbasophil
Function & Pathway
Protein Function (2)
- Predicted secreted proteins
- CD markers
Cellular Component (4)
Molecular Function (3)
Biological Process (3)
Reactome (2)
Canonical Pathways
M7 Pid fcer1 pathway
Mediation Categories
Immune mediation
Relations & Evidence30
Ligand-Receptor Signaling (29)
29 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | Yes | Yes | ||
| ecm | ecm | MatrixDB | Yes | Yes | Yes | ||
| ecm | ecm | OmniPath | Yes | Yes | Yes | ||
| intracellular | intracellular | GO_Intercell | Yes | Yes | |||
| intracellular | intracellular | OmniPath | Yes | Yes | |||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | Yes | |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| transmembrane | transmembrane | UniProt_location | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_topology | Yes | Yes |
Page 1 of 3Next
Sequence, Structure & Domains
Sequences
Length
453
Mass
49,913
Sequence
MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; Synonyms=Membrane-bound, CD33L1; IsoId=O43699-1; Sequence=Displayed; Name=2; Synonyms=Secreted, CD33L2; IsoId=O43699-2; Sequence=VSP_002553, VSP_002554; Name=3; IsoId=O43699-3; Sequence=VSP_035812; Name=4; IsoId=O43699-4; Sequence=VSP_035811, VSP_002553, VSP_002554; Name=5; IsoId=O43699-5; Sequence=VSP_045387, VSP_045388; Name=6; IsoId=O43699-6; Sequence=VSP_046070, VSP_035812
Alternative Sequence
23..58; Missing (in isoform 6); 143..153; Missing (in isoform 4); 236..252; YAPQKVAISIFQGNSAA -> S (in isoform 3 and isoform 6); 236; Y -> WMLRRPPLSTPD (in isoform 5); 339..391; KPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVM -> SSAPVPDRHSFRPPC (in isoform 2 and isoform 4); 371..453; KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK -> ISTSSRQA (in isoform 5); 392..453; Missing (in isoform 2 and isoform 4)
Domain & Motif Annotations
Motif
424..429; ITIM motif; 444..449; SLAM-like motif
Domain (CC)
Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
Domain (FT)
28..123; Ig-like V-type; 148..231; Ig-like C2-type 1; 238..333; Ig-like C2-type 2
Protein Families (2)
- Immunoglobulin superfamily
- SIGLEC (sialic acid binding Ig-like lectin) family
Sequence Similarities
Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 37713494 | ATP1A3 as a target for isolating neuron-specific extracellular vesicles from human brain and biofluids. | No related sentences available |