Protein detail
SIGL6
Sialic acid-binding Ig-like lectin 6 (Siglec-6) (CD33 antigen-like 1) (CDw327) (Obesity-binding protein 1) (OB-BP1) (CD antigen CD327)
Protein symbol SIGL6 | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteinsPredicted secreted proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Sialic acid-binding Ig-like lectin 6 (Siglec-6) (CD33 antigen-like 1) (CDw327) (Obesity-binding protein 1) (OB-BP1) (CD antigen CD327)
Protein Class
CD markersPredicted membrane proteinsPredicted secreted proteins
Protein Function
- Predicted secreted proteins
- CD markers
Transmembrane
348..368; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD327CD33LCD33L1OB-BP1SIGLEC-6
Gene Description
Sialic acid binding Ig like lectin 6
Chromosome
19
Position
51517819-51531856
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specifichippocampal CA4Blood Cell Specificbasophil
Function & Pathway
Protein Function
- Predicted secreted proteins
- CD markers
Cellular Component
Molecular Function
Biological Process
Reactome
Canonical Pathways
M7 Pid fcer1 pathway
Mediation Categories
Immune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
29 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Sequence, Structure & Domains
Sequences
Length
453
Mass
49,913
Sequence
MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; Synonyms=Membrane-bound, CD33L1; IsoId=O43699-1; Sequence=Displayed; Name=2; Synonyms=Secreted, CD33L2; IsoId=O43699-2; Sequence=VSP_002553, VSP_002554; Name=3; IsoId=O43699-3; Sequence=VSP_035812; Name=4; IsoId=O43699-4; Sequence=VSP_035811, VSP_002553, VSP_002554; Name=5; IsoId=O43699-5; Sequence=VSP_045387, VSP_045388; Name=6; IsoId=O43699-6; Sequence=VSP_046070, VSP_035812
Alternative Sequence
23..58; Missing (in isoform 6); 143..153; Missing (in isoform 4); 236..252; YAPQKVAISIFQGNSAA -> S (in isoform 3 and isoform 6); 236; Y -> WMLRRPPLSTPD (in isoform 5); 339..391; KPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVM -> SSAPVPDRHSFRPPC (in isoform 2 and isoform 4); 371..453; KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK -> ISTSSRQA (in isoform 5); 392..453; Missing (in isoform 2 and isoform 4)
3D Structural Models
Domain & Motif Annotations
Motif
424..429; ITIM motif; 444..449; SLAM-like motif
Domain (CC)
Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
Domain (FT)
28..123; Ig-like V-type; 148..231; Ig-like C2-type 1; 238..333; Ig-like C2-type 2
Protein Families
- Immunoglobulin superfamily
- SIGLEC (sialic acid binding Ig-like lectin) family
Sequence Similarities
Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.